Dataset for protein Bfl1 of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************** . *      : *  * *.::
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWrr-FvsvkhpqsGwrTsLsvt
                                                           eng rrkfekkr dl f els

       170    
....:....|....
  : .         
hpllr---------
gkickvlsllknyy
© 1998-2022Legal notice