Dataset for protein Bfl1 of organism Panthera tigris altaica

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9KZ34_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2A1 (length=174 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVLSLLKNYY
>gnl|bcl2dbpro|A0A8C9KZ34_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2A1 (length=164 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWRRFRSVKHKQRGDRTSLSLSH
PLLR
© 1998-2022Legal notice