Dataset for protein Bfl1 of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9KZ34_BCL2A1-      MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEK
A0A8C9KZ34_BCL2A1-      MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEK
                        **************************************************

A0A8C9KZ34_BCL2A1-      QLKPCLDKFHVGSVDTARTMFHQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A8C9KZ34_BCL2A1-      QLKPCLDKFHVGSVDTARTMFHQVMEKEFEDGIINWGRIVTIFAFEGILI
                        **************************************************

A0A8C9KZ34_BCL2A1-      KKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWRR-FRSVKHKQ
A0A8C9KZ34_BCL2A1-      KKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPK
                        *************************************** . *      :

A0A8C9KZ34_BCL2A1-      RGDRTSLSLSHPLLR---------
A0A8C9KZ34_BCL2A1-      SGWLTFLEVTGKICKVLSLLKNYY
                         *  * *.::  : .         

© 1998-2023Legal notice