Dataset for protein BCL-2-like of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----rnavinrnlvcdy-gykl-q-g--------------------------------------------pp-------
mfglka-s-dgle-yaggl---as-k-yswsqgslvavnrtaaprgtvsggetgsvipgstpapswttlapgavvvarps
 aaat-v-y----i---fasla-rsg avsggfrd eggkgetaprempepgipysqn rag sprhsppsd-trpv   
 mhtp tgsst s rvk-vh c ger  ecd      edae   e aegdm ffaalg n    apaladr-yrnht   
    m s qrk r ltelie     p                     aaa  a                 gsrlkg    
    g m pae a  m                                                      a   aa    
      d l                                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaegpdvtatppkllffaatrcasppekmqgpqadaimspeeeldgyepeplgkrpavlpllelvgeassgpgtdgsl
                              le  a                                             
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   . .  .                       
----------------------------------------gegpasrpvlqtlrrvgdsvqrrhrrafsgmlsqlhvtpg
pstpppaeeeedelfrqsleiisrylreqatgakdakplgasvavp-kahlaqqyaahgfeqnyettlqdlsrk-dikne
                               tkqsssams-rtrstsvqsevmkvl feqytkvqkqskpytm-f--ytv
                               aghrlrlgprpsiprqslka   qi aqislesk i ifcrgpdelgsf
                                 aa a da leclmprea      d rg f  f ae ad    er 
                                            hada                d  a  a       
                                              a                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .        :      ....:  :                                       ..  :       
davrsf-srvmvelfsdgv--nwgrivalfsfggflc-------------vesvsiemeslvgqlaewmveylvrhlrd-
tdyqrlfaqqvehvlrprytlsnnhvdtfivtsaavikrpprttynnltpl-qknrnqspciepvslsitdvinttkhgr
strktv ttlsrte vnpqrfq   m mirt epvmasll pgswli q gq-evkvwqvstsriqyivaal tnrtttn
nrqglm h  gnkc qg pi     l   ll a telek           kllqrl pdtnafnddthtg gkd gp 
eiiedi f  ekd  e  i           e   i   h           ahd e  eald dk cqfpf ef  ee 
  a    e   d                  a   d                   d    a   g         cd  a  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .:    *:                                                                     
---wlvkngGwd-----------gfvefygv-------------------------------------------------
hrariqsqr yyngfvrkfepkstwyllfhptgkickviahsqyqkskrisiflsmpeeveteeiirdifrqgktcfvpr
     rrsk  e           estttrsn                          ddl                    
     hqhd  a           d la lel                                                 
     geg               a c   cd                                                 
     ed                                                                         
      a                                                                         

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------------q
yrfqnnhmdmlrltspdeisllprtswnilqpgedevreealstgglrnvlvpglgvdkvgnrlgrgkgyydsyltrcl-
                                              idliflafa fagh ag         a  i   s
                                                                               n
                                                                               m
                                                                               g
                                                                               e

       490       500       510       520       530
....:....|....:....|....:....|....:....|....:....|
                                                  
q--s-rr-ve---------laflsvmtvr---------v-lglyfdsk--
are-k--tqarfnfswlsl---reqaclgvpvdehdvr-teva-e-rtls
-ldewpyl--l d      rwwa------tgavalgavid---l-w-r  
mpsgsiknrv         qnl-tlrl m       gl lvlsfysi-  
laa g  glp         k   ggfg l        c  i iallh   
d   a    l         g    c   a           a    g    
                                             a    
© 1998-2022Legal notice