Dataset for protein BCL-2-like of organism Panthera leo

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C8WKU6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Panthera leo GN=BCL2L10 (length=190 residues).
MADALRERRLLTDYLEYCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSAYRGYRGNRVELVARLERDLLSNPQTL
SWGHVVALLTFAGTLLERPPPGTYLNLTPGQQQELEWETNVGQDCQHLVALLCNRLTGRHRAWLEAHDGWDGFCLFFSPM
LPSSWRRLLVQAFLSCFTVMILIYFWRRLS
>gnl|bcl2dbpro|A0A8C8X938_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Panthera leo GN=BCL2A1 (length=202 residues).
MAAATAVSSAKRSLRAELKQRLRAMSAEERLRQSQLLAQKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCF
VPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEALSTGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTR
CLQQRDSKPYTVALAFREQMCLRVPVDEHDVRVDEVLYEDST
>gnl|bcl2dbpro|A0A8C8X938_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Panthera leo GN=BCL2A1 (length=327 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQP
GEDEVREEALSTGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVALAFREQMCLRVPVDEHDVRVDE
VLYEDST
>gnl|bcl2dbpro|A0A8C8XCR9_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Panthera leo GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C8XJU8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Panthera leo GN=BCL-2 (length=236 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAG
PALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C8Y0M9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Panthera leo GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C8Y0M9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Panthera leo GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C9D5N1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Panthera leo GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice