Dataset for protein BCL-2-like of organism Panthera leo

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8X938_BCL2A1-      -----------------------------------------------MAD
A0A8C8Y0M9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A8C8XJU8_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
A0A8C9D5N1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A8C8X938_BCL2A1-      MAAATAVSSAKRSLRAEL--------------------------------
A0A8C8Y0M9_MCL1-02      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSS-------------------
A0A8C8WKU6_BCL2L10      ----MADALRERRLLTDYLEYCAREPG-----------------------
A0A8C8XCR9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCG-------------------
                                                                          

A0A8C8X938_BCL2A1-      GEFGYVL----------TLARDYTKHV-----------------------
A0A8C8Y0M9_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A8C8XJU8_BCL2-01      PGIFSSQPGRTPAPARTSPPPPPVAPA-----------------------
A0A8C9D5N1_BCL2L1-      METPSAINGN---PSWHLADSPAVNGA-----------------------
A0A8C8X938_BCL2A1-      --------------------------------------------------
A0A8C8Y0M9_MCL1-02      --------------------GGRLVAT-----------------------
A0A8C8WKU6_BCL2L10      ---------------------SP---------------------------
A0A8C8XCR9_BCL2L2-      --------------------AGP---------------------------
                                                                          

A0A8C8X938_BCL2A1-      ----------LQGPQ-----------------------------------
A0A8C8Y0M9_MCL1-01      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A8C8XJU8_BCL2-01      --------------------------------------------------
A0A8C9D5N1_BCL2L1-      --------------------------------------------------
A0A8C8X938_BCL2A1-      --------------------------------------------------
A0A8C8Y0M9_MCL1-02      --------------------------------------------------
A0A8C8WKU6_BCL2L10      --------------------------------------------------
A0A8C8XCR9_BCL2L2-      --------------------------------------------------
                                                                          

A0A8C8X938_BCL2A1-      --------------------------------------------------
A0A8C8Y0M9_MCL1-01      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A8C8XJU8_BCL2-01      -----------------------------------------AAAAAAAGP
A0A8C9D5N1_BCL2L1-      -----------------------------------------TGHSSSLDA
A0A8C8X938_BCL2A1-      ------------------------------------------KQRLRAMS
A0A8C8Y0M9_MCL1-02      -----------------------------------------GAKDAKPLG
A0A8C8WKU6_BCL2L10      --------------------------------------------------
A0A8C8XCR9_BCL2L2-      --------------------------------------------------
                                                                          

A0A8C8X938_BCL2A1-      -PGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQV
A0A8C8Y0M9_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRV
A0A8C8XJU8_BCL2-01      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF-ATV
A0A8C9D5N1_BCL2L1-      REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSF-EQV
A0A8C8X938_BCL2A1-      AEERLRQSQLLAQKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDI-FRQ
A0A8C8Y0M9_MCL1-02      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRV
A0A8C8WKU6_BCL2L10      ARTPST-PEAAVLRYLAAQIRQRHQRFLSAYRG----YRGNRVELV-ARL
A0A8C8XCR9_BCL2L2-      GEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRF-TQV
                                   . .  .                            .    

A0A8C8X938_BCL2A1-      MEKEFEDGII-NWGRIVTIFAFEGILIKK-----------LLQERIVPDA
A0A8C8Y0M9_MCL1-01      MVHVFSDGVT-NWGRIVTLISFGAFVAKH-----------L--KSINQES
A0A8C8XJU8_BCL2-01      VEELFRDGV--NWGRIVAFFEFGGVMC-------------VESVNREMSP
A0A8C9D5N1_BCL2L1-      VNELFRDGV--NWGRIVAFFSFGGALC-------------VESVDKEMQV
A0A8C8X938_BCL2A1-      GKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEAL
A0A8C8Y0M9_MCL1-02      MVHVFSDGVT-NWGRIVTLISFGAFVA-------------KHLKSINQES
A0A8C8WKU6_BCL2L10      ERDLLSNPQTLSWGHVVALLTFAGTLLERPPPGTYLNLTPGQQQELEWET
A0A8C8XCR9_BCL2L2-      SDELFQGGP--NWGRLVAFFVFGAALC-------------AESVNKEMEP
                            :      ....:  :                               

A0A8C8X938_BCL2A1-      DAFKVSYFVAEFITKHTGE----WIRQNGGWENGFVRKFEPKSGWLTFLE
A0A8C8Y0M9_MCL1-01      CIEPLAESITDVLVRTKRD----WLVKQRGWD-----------GFVEFFH
A0A8C8XJU8_BCL2-01      LVDNIALWMTEYLNRHLHT----WIQDNGGWD-----------AFVELYG
A0A8C9D5N1_BCL2L1-      LVSRIATWMATYLNDHLEP----WIQENGGWD-----------TFVELYG
A0A8C8X938_BCL2A1-      STGGLDLIFVPGLGFDKHGN---RLGRGKGYY-----------DSYLTRC
A0A8C8Y0M9_MCL1-02      CIEPLAESITDVLVRTKRD----WLVKQRGWD-----------GFVEFFH
A0A8C8WKU6_BCL2L10      NVGQDCQHLVALLCNRLTGRHRAWLEAHDGWD-----------GFCLFFS
A0A8C8XCR9_BCL2L2-      LVGQVQEWMVAYLETRLAD----WIHSSGGWA-----------EFTALYG
                                ..  :          .:    *:                   

A0A8C8X938_BCL2A1-      VTGKICKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCFVPR
A0A8C8Y0M9_MCL1-01      V--------------------------EDLE-------------------
A0A8C8XJU8_BCL2-01      P-------------------------------------------------
A0A8C9D5N1_BCL2L1-      N-------------------------------------------------
A0A8C8X938_BCL2A1-      L-------------------------------------------------
A0A8C8Y0M9_MCL1-02      V-------------------------------------------------
A0A8C8WKU6_BCL2L10      P-------------------------------------------------
A0A8C8XCR9_BCL2L2-      D-------------------------------------------------
                                                                          

A0A8C8X938_BCL2A1-      YRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEALSTGGLDLI
A0A8C8Y0M9_MCL1-01      --------------------------------------------GGIRNV
A0A8C8XJU8_BCL2-01      --------------------------------------------------
A0A8C9D5N1_BCL2L1-      --------------------------------------------------
A0A8C8X938_BCL2A1-      --------------------------------------------------
A0A8C8Y0M9_MCL1-02      --------------------------------------------------
A0A8C8WKU6_BCL2L10      --------------------------------------------------
A0A8C8XCR9_BCL2L2-      --------------------------------------------------
                                                                          

A0A8C8X938_BCL2A1-      FVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVA---------L
A0A8C8Y0M9_MCL1-01      LLAFAGVAGVGAGL--------AYLIR-----------------------
A0A8C8XJU8_BCL2-01      -----------------------------SM-------QPLFDFSWLSLK
A0A8C9D5N1_BCL2L1-      -----------------------------NAAAESRKGQERFN------R
A0A8C8X938_BCL2A1-      -----------------------------QQRDSKPYTVA---------L
A0A8C8Y0M9_MCL1-02      -----------------------------EDLEGGIRNVL---------L
A0A8C8WKU6_BCL2L10      -----------------------------MLPSSWRRLLV---------Q
A0A8C8XCR9_BCL2L2-      -----------------------------GALEEARRLRE---------G
                                                                          

A0A8C8X938_BCL2A1-      AFREQMCLRVPVDEHDVRVDEVLYEDST--
A0A8C8Y0M9_MCL1-01      ------------------------------
A0A8C8XJU8_BCL2-01      ALLSLALVG-------ACITLGAYLGHK--
A0A8C9D5N1_BCL2L1-      WFLTGMTVA-------GVVLLGSLFSRK--
A0A8C8X938_BCL2A1-      AFREQMCLRVPVDEHDVRVDEVLYEDST--
A0A8C8Y0M9_MCL1-02      AFAGVAGVG-----------AGLAYLIR--
A0A8C8WKU6_BCL2L10      AFLSCFTVM-----------ILIYFWRRLS
A0A8C8XCR9_BCL2L2-      NWASVRTVLTGAVALGALVTVGAFFASK--
                                                      

© 1998-2022Legal notice