Dataset for protein BCL-2-like of organism Otus sunia

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                                                       
---------------g-rgyynrelvvdyvsyklsqrgy-----------------------------------------
mvqaastacpvpgms-tmsssvyyvcqkfrqgvaqlshlctglrtagarqhrgaggxxxxxxxxxxxxxxxxxxxxxxxx
           mahptrefgggagialaalh p lek c                                         
             de aa  d     i  ig                                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------w-age-----ppg---p-a--
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxeldgfepeaes-s---srppt---psv-p-gl
                                                          rgpqldeldgnrtdlppeddaa
                                                          d a   deael   faa a   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           *.                           .**  .. .  .    :  :  .:
-------------e--g---p-p---pPgstvvshap---g-------v-------aLRragdefsrryerafsqmlsql
rvdslelisryss-mt-vvs-s-swlg aqlrgpg--vhs-srvvpqv-qladvrqv  qvassvqqqtrldlrpltrri
aqaaaaaaagtlrdhd llnghakkhf  lhgan rapgrsllpmhkilha     t  ni  glmlkhqe  qgfsgk 
              aa eae g e      aa a   gae daeaeea e             ed      ad  d  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :         .  *    * **  ****::::: **. :     .            :   :*  :      *:  :**
hitpvtayqs-fvqVvqelFrDGv-NWGRivtffsFGgvlcvesvsremsvl---vssiaywmTeylvshlreWiqsnGG
elqsgevrkrivng mnhv s  nt    vmalit  alvtkklqnknvrptgeekgrlvsii maitrskhp lleq  
d  kfadlg   ee ae k a           i e   fma h keigqqlc   ieq sgf   nnn dn  dd   
    e  a    ca  a                     a      dh  ek     d   a      id  a    a   

       410       420       430       440       450      
....:....|....:....|....:....|....:....|....:....|....:.
*:  *:  :                                 .       *     
We-gFvdlyg-n------------f-------k-lls---v-gvltlgasLsrk--
 dnr lmkfrv-smegsvrnvrpt-nfswisr-w---lvt-taiilavsy gymyy
   a  ef e enlaaei kgqmf d     lrti tgslig cfi  fl fheir
            da       lea a       s   fak a  ag     a    
© 1998-2022Legal notice