Dataset for protein BCL-2-like of organism Otus sunia

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8AIP7_BCL2A1-      -------------METAEFYYVYYLAQDYLQYVLQESHL-----------
A0A8C8B1M7_MCL1-01      MVQAASTACPVPGDSGTAGGGGAGVCVAARGGPALLRGCCTGLRTAGARQ
A0A8C8A4L8_BCL2L1-      -----------------MSSSNRELVIDFVSYKLSQKGY-----------
A0A8C8ANG9_BCL2-01      -----------MAHPGRRGYDNREIVLKYIHYKLSQRGY-----------
                                                :                         

A0A8C8AIP7_BCL2A1-      --------------------------------------------------
A0A8C8B1M7_MCL1-01      HRGAGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C8A4L8_BCL2L1-      --------------------------------------------------
A0A8C8ANG9_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8AIP7_BCL2A1-      --------------------------------------------------
A0A8C8B1M7_MCL1-01      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C8A4L8_BCL2L1-      --------------------------------------------------
A0A8C8ANG9_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8AIP7_BCL2A1-      --------------------------------------------------
A0A8C8B1M7_MCL1-01      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C8A4L8_BCL2L1-      --------------------------------------------------
A0A8C8ANG9_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8AIP7_BCL2A1-      --------------------------------------------------
A0A8C8B1M7_MCL1-01      XXXXXXXXELDGFEPEAERGPAGDSLPGTPPGPPAPPDGLRQDSLELISR
A0A8C8A4L8_BCL2L1-      ------------------SWSQLEEEDENRTDFAVEDA------------
A0A8C8ANG9_BCL2-01      ------------------DWAAGEDRAPLPPGLSPPAAAAAVAAAAAAAG
                                                                          

A0A8C8AIP7_BCL2A1-      ----------------GPAQTRVAH---------------------VLRN
A0A8C8B1M7_MCL1-01      YLREAAGEAEPGAKKLFPGLLGGPGRPGGSGDAVMEKALE------TLRR
A0A8C8A4L8_BCL2L1-      ---EMDGVLNGSPSWHPPASHVVNGAAVHRSSLEVHEIVQAADVRQALRE
A0A8C8ANG9_BCL2-01      TSSDHTGLVSPHPE--PPGSAAASHAPPAEGLRPAPQVVHL-----ALRQ
                                         *.                           .** 

A0A8C8AIP7_BCL2A1-      IASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMQEKFADGNTNWGRI
A0A8C8B1M7_MCL1-01      VGDGVMQKHELAFQGMLRKLEIQKEEDLQS-VCEVAAHVFSDGVTNWGRV
A0A8C8A4L8_BCL2L1-      AGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFRDGV-NWGRI
A0A8C8ANG9_BCL2-01      AGDEFSRRYQRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDGV-NWGRI
                         .. .  .    :  :  .: :         .  *    * **  ****:

A0A8C8AIP7_BCL2A1-      MTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGG
A0A8C8B1M7_MCL1-01      VTLISFGAFVAKHLKSINQEKC---ISSLAGIITDALVSSKREWLLSQGG
A0A8C8A4L8_BCL2L1-      VAFFSFGGALCVESVDKEMRVL---VGRIVSWMTMYLTDHLDPWIQENGG
A0A8C8ANG9_BCL2-01      VAFFEFGGVMCVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGG
                        :::: **. :     .            :   :*  :      *:  :**

A0A8C8AIP7_BCL2A1-      WENGFLMKFE---------------------RRSLLSFSKITAIFIAVFS
A0A8C8B1M7_MCL1-01      WE-GFVDFFRVEDLEGSIRNVLMAFA----------------GVAGLGAS
A0A8C8A4L8_BCL2L1-      WE-RFVDLYG-NNAAAEVRKGQETFN------KWLLTGATVAGVLLLGSL
A0A8C8ANG9_BCL2-01      WD-AFVELYG-NSM-------RPFFDFSWISLKTILSLVLVGACITLGAY
                        *:  *:  :                                 .       

A0A8C8AIP7_BCL2A1-      LFREYY
A0A8C8B1M7_MCL1-01      LAYMIR
A0A8C8A4L8_BCL2L1-      LSRK--
A0A8C8ANG9_BCL2-01      LGHK--
                        *     

© 1998-2022Legal notice