Dataset for protein BCL-2-like of organism Otus sunia

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8A4L8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Otus sunia GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEDAEMDGVLNGSPSWHPPASHVVNGAAVHRSSLEVHEIVQA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVSWMTMYLTDHLDPWIQENGGWERFVDLYGNNAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C8AIP7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Otus sunia GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMQEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLMKFERRSLLSFSKIT
AIFIAVFSLFREYY
>gnl|bcl2dbpro|A0A8C8ANG9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Otus sunia GN=BCL-2 (length=243 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAAGTSSDHTGLVSPHPEPPGSAA
ASHAPPAEGLRPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGV
MCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPFFDFSWISLKTILSLVLVGACITLGAYL
GHK
>gnl|bcl2dbpro|A0A8C8B1M7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Otus sunia GN=MCL-1 (length=429 residues).
MVQAASTACPVPGDSGTAGGGGAGVCVAARGGPALLRGCCTGLRTAGARQHRGAGGXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELDGFEPEAERGPAGDSLPGTPPGPPAPPDGL
RQDSLELISRYLREAAGEAEPGAKKLFPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEE
DLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLLSQGGWEGFVDFFRV
EDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice