Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
      .      :                .:* *                                             
m---mnrqllsfhitsncgftghilgstagel a vplpstlasrvanpdpsdqlkrpqdld-sarrfhdt--pnrtad-
 sshct wtkrwav             dhls  q          h         f      s --------es     - 
 acgrr sk av               a     k                           n vlnhivln n     a 
  mss   i vk               k                                 g  cg              
  nv      e                c                                                    

        90       100       110       120       130       140       150       160
                                                          .   .:   : :  :      :
----aanngsvg-- ----r-q---gt-pdees  qgtpplsplrearpspsenladmhelar meaqyqpl stlaqnm
qvg         eq tethanptfa  c       r         iqql sttp   v  a q tgn l  ala ne 
 r             dtpv  lcd                       a  rad           a        qrd t  
               p     g                                                          

       170       180       190       200       210       220       230       240
              .  * ..*. *   ****::.:: * ..:. .   :   .                  : : :  :
rldlhidqdddmqfvkr aks va ett    iigflv vavvaqsckeqrgrsegldpgrevapgpvccslvsqeicqf
hkh ylsgp lctslrk m  r nrl      a  e   t  rq rsnte np         a   s qalv tvad 
 s     sa  k r en i  g   v                   a  ed  t             q as      v 
 r      t      ae                                                             e 

       250       260       270       280       290       300       310         
*      *: .:..*: *  :   .          :... :               :                      
 leeqrn lhnhns ec vrlyrvndp--a--fesslrntmvvflailg---lfvfitkl-mmaifkglpasarlhnsr
 ggdkke mleq  r cki---erttrevsqdt m tafflaasvglagtt lyvr--nr          t    w 
 nnhlqs  q      a     drqae vsscswp f  v g gmtg asv i s     sl                 
   p n   e               k   f  y   i        l                                 
© 1998-2022Legal notice