Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3IJ04_MCL1-01      -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPD
A0A3P9L1F3_MCL1-01      -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPD
A0A3B3IJ04_MCL1-02      -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPD
A0A3P9L1F3_MCL1-02      -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPD
A0A3P9ILF6_MCL1-02      -MFPLQKQMVNSYITSNCGFTGHILG-RAGEMSARVPLPSTLASRVANPD
A0A3P9ILF6_MCL1-01      -MFPLQKQMVNSYITSNCGFTGHILG-RAGEMSARVPLPSTLASRVANPD
A0A3P9IIZ2_BCL2L10      MSCGLRKETLAVAL-------------DYLSLSCR---------------
A0A3P9LM07_BCL2L10      MSCGLRKETLAVAL-------------DYLSLSCR---------------
H2MBQ3_BCL2L10-01       MSCGLRKETLAVAL-------------DYLSLSCR---------------
A0A3B3IB64_BCL2L1-      --MSRNRELVVFYV-------------KY-KLSQR---------------
A0A3P9JYH1_BCL2L1-      --MSRNRELVVFYV-------------KY-KLSQR---------------
A0A3B3I2Q5_BCL2L1-      -MSHCNRELVRFYL-------------AY-KMSCR---------------
A0A3P9I2N4_BCL2L1-      -MSHCNRELVRFYL-------------AY-KMSCR---------------
A0A3P9MKK4_BCL2L1-      -MSHCNRELVRFYL-------------AY-KMSCR---------------
A0A3P9J8Y9_BCL2-01      MANVSNRSIVEKYI-------------CH-KLSKR---------------
A0A3P9MKK4_BCL2L1-      ----MTKWKKSWHL-------------TY-KMSCR---------------
A0A3B3I2Q5_BCL2L1-      ----MTKWKKSWHL-------------TY-KMSCR---------------
A0A3P9I2N4_BCL2L1-      ----MTKWKKSWHL-------------TY-KMSCR---------------
                              .      :                .:* *               

A0A3B3IJ04_MCL1-01      PSDQLKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3P9L1F3_MCL1-01      PSDQLKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3B3IJ04_MCL1-02      PSDQLKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3P9L1F3_MCL1-02      PSDQLKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3P9ILF6_MCL1-02      PSDQFKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3P9ILF6_MCL1-01      PSDQFKRPQDLEYSARRFHDVDD-----DGSLPNTPELECEASVSGDNSG
A0A3P9IIZ2_BCL2L10      -----------S--------------------------------------
A0A3P9LM07_BCL2L10      -----------S--------------------------------------
H2MBQ3_BCL2L10-01       -----------S--------------------------------------
A0A3B3IB64_BCL2L1-      -----------NYPLNHIVLNESPNRTAAGEVGE--------EQSTETHA
A0A3P9JYH1_BCL2L1-      -----------NYPLNHIVLNESPNRTAAGEVGE--------EQSTETHA
A0A3B3I2Q5_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSDARNR
A0A3P9I2N4_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSAARNG
A0A3P9MKK4_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSAARNG
A0A3P9J8Y9_BCL2-01      -----------GYVCGL-----N-----GGQRENAANNGSVGDHSPTPVR
A0A3P9MKK4_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSAARNG
A0A3B3I2Q5_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSDARNR
A0A3P9I2N4_BCL2L1-      -----------DYPVSLLKPTDD-----GGETEE--------DHSAARNG
                                                                          

A0A3B3IJ04_MCL1-01      IDALNEDTTEFLT--NFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHK
A0A3P9L1F3_MCL1-01      IDALNEDTTEFLT--NFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHK
A0A3B3IJ04_MCL1-02      IDALNEDTTEFLT--NFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHK
A0A3P9L1F3_MCL1-02      IDALNEDTTEFLT--NFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHK
A0A3P9ILF6_MCL1-02      IDALNEDTTEFLT--NFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHK
A0A3P9ILF6_MCL1-01      IDALNEDTTEFLT--NFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHK
A0A3P9IIZ2_BCL2L10      ---------------P--------LQAPPPPSESAAAMRRLAQDMEAQYQ
A0A3P9LM07_BCL2L10      ---------------P--------LQAPPPPSESAAAMRRLAQDMEAQYQ
H2MBQ3_BCL2L10-01       ---------------P--------LQAPPPPSESAAAMRRLAQDMEAQYQ
A0A3B3IB64_BCL2L1-      NGTFNGTT-------PGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFE
A0A3P9JYH1_BCL2L1-      NGTFNGTT-------PGTPPLSPLREQQLPSTTNMDAVKEALRDTANEFE
A0A3B3I2Q5_BCL2L1-      RLVSSEDG-------R--------LRRSCPCCASMDAIKSTLKDSADEFE
A0A3P9I2N4_BCL2L1-      RQVSSEDG-------Q--------LRRSCPCCASMDAIKSTLKDSADEFE
A0A3P9MKK4_BCL2L1-      RPVSSEDC-------Q--------LRRSCPCCASMDAIKSTLKDSADEFE
A0A3P9J8Y9_BCL2-01      RRCDAGTGPDEESSPR--------LIRALSRADPLADIHRVLREAGDELE
A0A3P9MKK4_BCL2L1-      RPVSSEDC-------Q--------LRRSCPCCASMDAIKSTLKDSADEFE
A0A3B3I2Q5_BCL2L1-      RLVSSEDG-------R--------LRRSCPCCASMDAIKSTLKDSADEFE
A0A3P9I2N4_BCL2L1-      RQVSSEDG-------Q--------LRRSCPCCASMDAIKSTLKDSADEFE
                                                              .   .:   : :

A0A3B3IJ04_MCL1-01      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3P9L1F3_MCL1-01      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3B3IJ04_MCL1-02      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3P9L1F3_MCL1-02      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3P9ILF6_MCL1-02      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3P9ILF6_MCL1-01      ITYNGMIVRLSLD---DQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFG
A0A3P9IIZ2_BCL2L10      PRFSTLAQNFRKH---SGQDLCSSLRKVMEELVGDERLNWGRVVSLFAFV
A0A3P9LM07_BCL2L10      PRFSTLAQNFRKH---SGPDLCSSLRKVMEELVGDERLNWGRVVSLFAFV
H2MBQ3_BCL2L10-01       PRFSTLAQNFRKH---SGPDLCSSLRKVMEELVGDERLNWGRVVSLFAFV
A0A3B3IB64_BCL2L1-      LRYALAFNNLHSQLHITPATAYQSFENVMNELFRDN-INWGRIVGLFAFG
A0A3P9JYH1_BCL2L1-      LRYALAFNNLHSQLHITPATAYQSFENVMNELFRDN-INWGRIVGLFAFG
A0A3B3I2Q5_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
A0A3P9I2N4_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
A0A3P9MKK4_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
A0A3P9J8Y9_BCL2-01      RLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDG-VNWGRIIAFFEFG
A0A3P9MKK4_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
A0A3B3I2Q5_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
A0A3P9I2N4_BCL2L1-      RRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDG-INWGRVVGLFVFG
                          :      :              .  * ..*. *   ****::.:: * 

A0A3B3IJ04_MCL1-01      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3P9L1F3_MCL1-01      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3B3IJ04_MCL1-02      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3P9L1F3_MCL1-02      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3P9ILF6_MCL1-02      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3P9ILF6_MCL1-01      AAVCQSLK-EKGRGH-------------CVDLVSQEICTYLLSEQRNWLV
A0A3P9IIZ2_BCL2L10      GVLARQLREQTDMNPGLDPGREVAAGPVSCQALAETVADFLGGDKKEWML
A0A3P9LM07_BCL2L10      GVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWML
H2MBQ3_BCL2L10-01       GVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWML
A0A3B3IB64_BCL2L1-      GALCVECV-EKEMSP-------------LVDRIVEWMTVYLDNHIQPWIQ
A0A3P9JYH1_BCL2L1-      GALCVECV-EKEMSP-------------LVDRIVEWMTVYLDNHIQPWIQ
A0A3B3I2Q5_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
A0A3P9I2N4_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
A0A3P9MKK4_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
A0A3P9J8Y9_BCL2-01      GTVCVECASNEEMST-------------QVASIAEWMTEYLNGPLNSWIE
A0A3P9MKK4_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
A0A3B3I2Q5_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
A0A3P9I2N4_BCL2L1-      GALCVECV-ERNMGE-------------LVSRIAEWMTQYLDEQISPWIH
                        ..:. .   :   .                  : : :  :*      *: 

A0A3B3IJ04_MCL1-01      NNNSWDGFVEFFRVSDP------ETTVRNTLVAFLGIAG---VGALLAQL
A0A3P9L1F3_MCL1-01      NNNSWDGFVEFFRVSDP------ESTVRNTLVAFLGIAG---VGALLAQL
A0A3B3IJ04_MCL1-02      NNNSWDGFVEFFRVSDP------ETTVRNTLVAFLGIAG---VGALLAQL
A0A3P9L1F3_MCL1-02      NNNSWDGFVEFFRVSDP------ESTVRNTLVAFLGIAG---VGALLAQL
A0A3P9ILF6_MCL1-02      NNNSWDGFVEFFRVSDP------ETTVRNTLVAFLGIAG---VGALLAQL
A0A3P9ILF6_MCL1-01      NNNSWDGFVEFFRVSDP------ETTVRNTLVAFLGIAG---VGALLAQL
A0A3P9IIZ2_BCL2L10      ENDGWEGFCKF---SRTAREVSQDSSMKTALFAAASVGLAGLTFLLVR--
A0A3P9LM07_BCL2L10      ENDGWEGFCKF---SRTAREVSQDSSMKTALFAAASVGLAGLTFLLVR--
H2MBQ3_BCL2L10-01       ENDGWEGFCKF---SRTAREVSQDSSMKTALFAAASVGLAGLTFLLVR--
A0A3B3IB64_BCL2L1-      SQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQK
A0A3P9JYH1_BCL2L1-      SQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQK
A0A3B3I2Q5_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
A0A3P9I2N4_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
A0A3P9MKK4_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
A0A3P9J8Y9_BCL2-01      ENGGWDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLAQK
A0A3P9MKK4_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
A0A3B3I2Q5_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
A0A3P9I2N4_BCL2L1-      SHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKK
                        .:..*: *  :   .          :... :               :   

A0A3B3IJ04_MCL1-01      SR-----------------
A0A3P9L1F3_MCL1-01      SR-----------------
A0A3B3IJ04_MCL1-02      NMMAIFKGLPASTRLHNSR
A0A3P9L1F3_MCL1-02      NMMAIFKGLPASARLHNWR
A0A3P9ILF6_MCL1-02      NMMAIFKGLPASARLHNSR
A0A3P9ILF6_MCL1-01      -----------------SR
A0A3P9IIZ2_BCL2L10      -------------------
A0A3P9LM07_BCL2L10      -------------------
H2MBQ3_BCL2L10-01       -------------------
A0A3B3IB64_BCL2L1-      RL-----------------
A0A3P9JYH1_BCL2L1-      RL-----------------
A0A3B3I2Q5_BCL2L1-      R------------------
A0A3P9I2N4_BCL2L1-      R------------------
A0A3P9MKK4_BCL2L1-      R------------------
A0A3P9J8Y9_BCL2-01      -------------------
A0A3P9MKK4_BCL2L1-      R------------------
A0A3B3I2Q5_BCL2L1-      R------------------
A0A3P9I2N4_BCL2L1-      R------------------
                                           

© 1998-2020Legal notice