Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A3B3IJ04_MCL1-02         MFP-L-QKQMVNSYITS-NCGFTGHILGSRAGEMSARVPLPSTLASHVAN
A0A3P9J8Y9_BCL2-01         MANVS-NRSIVEKYICH-KLSKRGY-------------VCGLN-GGQREN
A0A3B3IB64_BCL2L1-01       MSR---NRELVVFYVKY-KLSQRNY-------------PLNHIVLNESPN
A0A3B3I2Q5_BCL2L1-01       MSH-C-NRELVRFYLAY-KMSCRDY-------------PVSLLKPTD---
A0A3P9IIZ2_BCL2L10-01      MSC-GLRKETLAVALDYLSLSCRS--------------PLQAP-------
A0A3B3I2Q5_BCL2L1-02       MTK-W-KK---SWHLTY-KMSCRDY-------------PVSLLKPTD---
A0A3B3IJ04_MCL1-01         MFP-L-QKQMVNSYITS-NCGFTGHILGSRAGEMSARVPLPSTLASHVAN
A0A3P9I2N4_BCL2L1-02       MTK-W-KK---SWHLTY-KMSCRDY-------------PVSLLKPTD---
A0A3P9I2N4_BCL2L1-01       MSH-C-NRELVRFYLAY-KMSCRDY-------------PVSLLKPTD---
A0A3P9ILF6_MCL1-02         MFP-L-QKQMVNSYITS-NCGFTGHILG-RAGEMSARVPLPSTLASRVAN
A0A3P9ILF6_MCL1-01         MFP-L-QKQMVNSYITS-NCGFTGHILG-RAGEMSARVPLPSTLASRVAN
A0A3P9L1F3_MCL1-01         MFP-L-QKQMVNSYITS-NCGFTGHILGSRAGEMSARVPLPSTLASRVAN
A0A3P9L1F3_MCL1-02         MFP-L-QKQMVNSYITS-NCGFTGHILGSRAGEMSARVPLPSTLASRVAN
A0A3P9LM07_BCL2L10-01      MSC-GLRKETLAVALDYLSLSCRS--------------PLQAP-------
A0A3P9MKK4_BCL2L1-02       MTK-W-KK---SWHLTY-KMSCRDY-------------PVSLLKPTD---
A0A3P9MKK4_BCL2L1-01       MSH-C-NRELVRFYLAY-KMSCRDY-------------PVSLLKPTD---
A0A3P9JYH1_BCL2L1-01       MSR---NRELVVFYVKY-KLSQRNY-------------PLNHIVLNESPN
H2MBQ3_BCL2L10-01          MSC-GLRKETLAVALDYLSLSCRS--------------PLQAP-------
                           *     .:      :   . .  .                          

A0A3B3IJ04_MCL1-02         PDPSDQLKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9J8Y9_BCL2-01         AANNGSVGD-HSPTPVR-RRCDAGTGPDE-ESSPRLIRALSRADPLADIH
A0A3B3IB64_BCL2L1-01       RTAAGEVGE-EQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVK
A0A3B3I2Q5_BCL2L1-01       --DGGETEEDHSDARNR-RLVSSED--------GRLRRSCPCCASMDAIK
A0A3P9IIZ2_BCL2L10-01      -------------------------------------------PPPSESA
A0A3B3I2Q5_BCL2L1-02       --DGGETEEDHSDARNR-RLVSSED--------GRLRRSCPCCASMDAIK
A0A3B3IJ04_MCL1-01         PDPSDQLKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9I2N4_BCL2L1-02       --DGGETEEDHSAARNG-RQVSSED--------GQLRRSCPCCASMDAIK
A0A3P9I2N4_BCL2L1-01       --DGGETEEDHSAARNG-RQVSSED--------GQLRRSCPCCASMDAIK
A0A3P9ILF6_MCL1-02         PDPSDQFKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9ILF6_MCL1-01         PDPSDQFKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9L1F3_MCL1-01         PDPSDQLKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9L1F3_MCL1-02         PDPSDQLKR-PQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-
A0A3P9LM07_BCL2L10-01      -------------------------------------------PPPSESA
A0A3P9MKK4_BCL2L1-02       --DGGETEEDHSAARNG-RPVSSED--------CQLRRSCPCCASMDAIK
A0A3P9MKK4_BCL2L1-01       --DGGETEEDHSAARNG-RPVSSED--------CQLRRSCPCCASMDAIK
A0A3P9JYH1_BCL2L1-01       RTAAGEVGE-EQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVK
H2MBQ3_BCL2L10-01          -------------------------------------------PPPSESA
                                                                             

A0A3B3IJ04_MCL1-02         DALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9J8Y9_BCL2-01         RVLREAGDELERLYQRDFTE------------------------------
A0A3B3IB64_BCL2L1-01       EALRDTANEFELRYALAFNN------------------------------
A0A3B3I2Q5_BCL2L1-01       STLKDSADEFERRFHQGFSD------------------------------
A0A3P9IIZ2_BCL2L10-01      AAMRRLAQDMEAQYQPRFST------------------------------
A0A3B3I2Q5_BCL2L1-02       STLKDSADEFERRFHQGFSD------------------------------
A0A3B3IJ04_MCL1-01         DALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9I2N4_BCL2L1-02       STLKDSADEFERRFHQGFSD------------------------------
A0A3P9I2N4_BCL2L1-01       STLKDSADEFERRFHQGFSD------------------------------
A0A3P9ILF6_MCL1-02         DALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9ILF6_MCL1-01         DALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9L1F3_MCL1-01         DALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9L1F3_MCL1-02         DALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITY
A0A3P9LM07_BCL2L10-01      AAMRRLAQDMEAQYQPRFST------------------------------
A0A3P9MKK4_BCL2L1-02       STLKDSADEFERRFHQGFSD------------------------------
A0A3P9MKK4_BCL2L1-01       STLKDSADEFERRFHQGFSD------------------------------
A0A3P9JYH1_BCL2L1-01       EALRDTANEFELRYALAFNN------------------------------
H2MBQ3_BCL2L10-01          AAMRRLAQDMEAQYQPRFST------------------------------
                            .:.    ::   :   *                                

A0A3B3IJ04_MCL1-02         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9J8Y9_BCL2-01         --MSRQLYLTS-TTAKTR-FAEVIDELFRD-GVNWGRIIAFFEFGGTVCV
A0A3B3IB64_BCL2L1-01       --LHSQLHITP-ATAYQS-FENVMNELFRD-NINWGRIVGLFAFGGALCV
A0A3B3I2Q5_BCL2L1-01       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3P9IIZ2_BCL2L10-01      --LAQNFRKHSGQDLCSS-LRKVMEELVGDERLNWGRVVSLFAFVGVLAR
A0A3B3I2Q5_BCL2L1-02       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3B3IJ04_MCL1-01         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9I2N4_BCL2L1-02       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3P9I2N4_BCL2L1-01       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3P9ILF6_MCL1-02         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9ILF6_MCL1-01         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9L1F3_MCL1-01         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9L1F3_MCL1-02         NGMIVRLSLDD-QGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQ
A0A3P9LM07_BCL2L10-01      --LAQNFRKHSGPDLCSS-LRKVMEELVGDERLNWGRVVSLFAFVGVLAR
A0A3P9MKK4_BCL2L1-02       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3P9MKK4_BCL2L1-01       --LSVQLHITP-DTAYQN-FKRVLDELFKD-GINWGRVVGLFVFGGALCV
A0A3P9JYH1_BCL2L1-01       --LHSQLHITP-ATAYQS-FENVMNELFRD-NINWGRIVGLFAFGGALCV
H2MBQ3_BCL2L10-01          --LAQNFRKHSGPDLCSS-LRKVMEELVGDERLNWGRVVSLFAFVGVLAR
                             :  .:            .  * ..*. *   ****::.:: * ..:. 

A0A3B3IJ04_MCL1-02         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9J8Y9_BCL2-01         ECASNEEMSTQV-------------ASIAEWMTEYLNGPLNSWIEENGGW
A0A3B3IB64_BCL2L1-01       ECVE-KEMSPLV-------------DRIVEWMTVYLDNHIQPWIQSQGGW
A0A3B3I2Q5_BCL2L1-01       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3P9IIZ2_BCL2L10-01      QLREQTDMNPGLDPGREVAAGPVSCQALAETVADFLGGDKKEWMLENDGW
A0A3B3I2Q5_BCL2L1-02       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3B3IJ04_MCL1-01         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9I2N4_BCL2L1-02       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3P9I2N4_BCL2L1-01       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3P9ILF6_MCL1-02         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9ILF6_MCL1-01         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9L1F3_MCL1-01         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9L1F3_MCL1-02         SLKE-KGRGHCV-------------DLVSQEICTYLLSEQRNWLVNNNSW
A0A3P9LM07_BCL2L10-01      QLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGW
A0A3P9MKK4_BCL2L1-02       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3P9MKK4_BCL2L1-01       ECVE-RNMGELV-------------SRIAEWMTQYLDEQISPWIHSHGGW
A0A3P9JYH1_BCL2L1-01       ECVE-KEMSPLV-------------DRIVEWMTVYLDNHIQPWIQSQGGW
H2MBQ3_BCL2L10-01          QLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGW
                           .  .    .  :               : : :  :*      *: .:..*

A0A3B3IJ04_MCL1-02         DGFVEFFRVSDPETT--VRNTLVAFL-GIAGVGALLAQLNMMAIFKGLPA
A0A3P9J8Y9_BCL2-01         DAFVELYDRQKETVFSCYWPSIKTVF-GLAA-----------LGAASLTI
A0A3B3IB64_BCL2L1-01       ERFAEIFGQEAAAESRRSQESFKKWL-LVGM-----------TVATGVLV
A0A3B3I2Q5_BCL2L1-01       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3P9IIZ2_BCL2L10-01      EGFCKFSRTAREV-S--QDSSMKTALFAAAS-----------VGLAGLT-
A0A3B3I2Q5_BCL2L1-02       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3B3IJ04_MCL1-01         DGFVEFFRVSDPETT--VRNTLVAFL-GIAGVGALLAQL-----------
A0A3P9I2N4_BCL2L1-02       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3P9I2N4_BCL2L1-01       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3P9ILF6_MCL1-02         DGFVEFFRVSDPETT--VRNTLVAFL-GIAGVGALLAQLNMMAIFKGLPA
A0A3P9ILF6_MCL1-01         DGFVEFFRVSDPETT--VRNTLVAFL-GIAGVGALLAQL-----------
A0A3P9L1F3_MCL1-01         DGFVEFFRVSDPEST--VRNTLVAFL-GIAGVGALLAQL-----------
A0A3P9L1F3_MCL1-02         DGFVEFFRVSDPEST--VRNTLVAFL-GIAGVGALLAQLNMMAIFKGLPA
A0A3P9LM07_BCL2L10-01      EGFCKFSRTAREV-S--QDSSMKTALFAAAS-----------VGLAGLT-
A0A3P9MKK4_BCL2L1-02       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3P9MKK4_BCL2L1-01       DCFARLYGQNGAAEARRFQETLKKWM-LVTV-----------ALLTGLLL
A0A3P9JYH1_BCL2L1-01       ERFAEIFGQEAAAESRRSQESFKKWL-LVGM-----------TVATGVLV
H2MBQ3_BCL2L10-01          EGFCKFSRTAREV-S--QDSSMKTALFAAAS-----------VGLAGLT-
                           : * .:              ::   :                        

A0A3B3IJ04_MCL1-02         STRLHN-SR
A0A3P9J8Y9_BCL2-01         GAYLAQ--K
A0A3B3IB64_BCL2L1-01       GSFLAQKRL
A0A3B3I2Q5_BCL2L1-01       GVLITK-KR
A0A3P9IIZ2_BCL2L10-01      --FLLV--R
A0A3B3I2Q5_BCL2L1-02       GVLITK-KR
A0A3B3IJ04_MCL1-01         -------SR
A0A3P9I2N4_BCL2L1-02       GVLITK-KR
A0A3P9I2N4_BCL2L1-01       GVLITK-KR
A0A3P9ILF6_MCL1-02         SARLHN-SR
A0A3P9ILF6_MCL1-01         -------SR
A0A3P9L1F3_MCL1-01         -------SR
A0A3P9L1F3_MCL1-02         SARLHN-WR
A0A3P9LM07_BCL2L10-01      --FLLV--R
A0A3P9MKK4_BCL2L1-02       GVLITK-KR
A0A3P9MKK4_BCL2L1-01       GVLITK-KR
A0A3P9JYH1_BCL2L1-01       GSFLAQKRL
H2MBQ3_BCL2L10-01          --FLLV--R
                                    

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice