Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bcl2dbpro|A0A3B3I2Q5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3I2Q5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSDARNRRLVSSEDGRLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3B3IB64_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3B3IJ04_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=268 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|A0A3B3IJ04_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=285 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPETTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASTRLHNSR
>gnl|bcl2dbpro|A0A3P9I2N4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRQVSSEDGQLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9I2N4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRQVSSEDGQLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9IIZ2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGQDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAAGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9ILF6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=284 residues).
MFPLQKQMVNSYITSNCGFTGHILGRAGEMSARVPLPSTLASRVANPDPSDQFKRPQDLEYSARRFHDVDDDGSLPNTPE
LECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDDM
SFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSD
PETTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASARLHNSR
>gnl|bcl2dbpro|A0A3P9ILF6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=267 residues).
MFPLQKQMVNSYITSNCGFTGHILGRAGEMSARVPLPSTLASRVANPDPSDQFKRPQDLEYSARRFHDVDDDGSLPNTPE
LECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYPHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDDM
SFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSD
PETTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|A0A3P9J8Y9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias latipes GN=BCL-2 (length=228 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQRENAANNGSVGDHSPTPVRRRCDAGTGPDEESSPRLIRALSRADPLADI
HRVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVAS
IAEWMTEYLNGPLNSWIEENGGWDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A3P9JYH1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A3P9L1F3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=285 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPESTVRNTLVAFLGIAGVGALLAQLNMMAIFKGLPASARLHNWR
>gnl|bcl2dbpro|A0A3P9L1F3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias latipes GN=MCL-1 (length=268 residues).
MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASRVANPDPSDQLKRPQDLEYSARRFHDVDDDGSLPNTP
ELECEASVSGDNSGIDALNEDTTEFLTNFFRNFVGISQYRHRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDD
MSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVS
DPESTVRNTLVAFLGIAGVGALLAQLSR
>gnl|bcl2dbpro|A0A3P9LM07_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9MKK4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRPVSSEDCQLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A3P9MKK4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSAARNGRPVSSEDCQLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|H2MBQ3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias latipes GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
© 1998-2020Legal notice