Dataset for protein BCL-2-like of organism Oryzias javanicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        ::   :   :* .   ..                      
---------------------------------afivnrvlvlyyisyklSprpyplngahvvvtggstg---igksqai
msskegfssavtdwlfinswwillpfimllivv-msrafeilvfmvkpli qknlkvshivlnespnrg-aeev-eeist
                                mmsvsh s  qk lgh m s g vfg-----------a   -d-gehr
                                  nhc     e   c    k d    llkptdd  q     l g  de
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   :*::                                          :  .:.:: :::          :   :  :
ecfrnGtfitlvp---------gt-p-------sqvvlcvsvpissdytqvknvlkqaqeele------fgpvdmqlnit
sthaq alngtsardedkllka--p-lkfaindkplrqqqlpdsttnmdaieeairdtankf-rryala-nnlsslvhca
davn  vnsedtpvrrrcd kkeve      d-eqspr irclnshad hst  esgd   llfyrg temhv  yl 
  ac    gdr             g r      -gd  kk c acep     r             qqd sd  r     
                                  e                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :.   * .:  * *.   :      ..:   .          :   .  .                            
pttayqkFeevevElFk-dnmnwgrivglfpfgg---lcvecv-eremsrlv----------------------------
gaavags knmmn r rielievnylisvyatrafda-vittmkqkrqgpiafvssqagqiglfgytgyspssqmemkpy
sd  ktr as ld     vgvglf vgaf yl s  vv rr asden  kt             alralae lllc    
      n          t     t    v     ti     i     eq                             
                              e     s                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------nrivewmtvyldetiqpwiqsq--------------------ggw---------------
niyvtvafppdtdtpllaeedkskple-klisnhsgv-qpd-vakvfvkdavqgnfnssvgpd-ymlsaltcgmspvtsi
                    ssta--- --------- ---n                    - -l pehqll rdikpa
                    a  e    m  ngqlss  h                                        
                            e    p n   e                                        

       330       340       350       360       370       380  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
-------drfaelygq--aae-rr-qes-kkwllvamlgatgllvgsyiaqk----------
teglqqhea-v-if--qk---s--y---i-tvfglgatv-asvti-afl---rlsktankte
apqrht --t-r--dreaetvfscswptf ---------s-----r---ikreq        
       iv mg    dg   a  f   l rtta fyallfdsil rlm             
        c                       i   v         lc              
© 1998-2020Legal notice