Dataset for protein BCL-2-like of organism Oryzias javanicus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3S2PV78_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias javanicus GN=BCL-2 (length=225 residues).
MANVSHRSIVEKYICHKLSKRGYVFGLDGGQHEDAANNGSLGDRSPTPVRRRCDAGTGPDGERSPRLIRALEPHADIHRV
LREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASDEEMSAQVASIAE
WMTEYLNGPLNSWIEDNGGWDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A3S2PV78_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias javanicus GN=BCL-2 (length=322 residues).
MLLIVVAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSGGIGKSIAIECFRQGAFITLVARDEDKLLKAKKEVEKFA
INDKQVVLCVSVDISSDYTQVENVIKQAQEKLGPVDMLVNCAGTAVAGKFEEMEVERFKELMEVNYLGSVYPTRAVITTM
KERRMGRIVFVSSQFALRGLAESLQMEMKPYNIYVTVAFPPDTDTPLLAEENKSKPLETKLISETSGVWQPDQVAKVFVK
DAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLA
QK
>gnl|bcl2dbpro|A0A3S2PV78_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias javanicus GN=BCL-2 (length=349 residues).
MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSGGIGKSIAIECF
RQGAFITLVARDEDKLLKAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKLGPVDMLVNCAGTAVAGKFEEM
EVERFKELMEVNYLGSVYPTRAVITTMKERRMGRIVFVSSQAGQIGLFGYTAYSPSSLLCMKPYNIYVTVAFPPDTDTPL
LAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFRTI
ALFYLGSFDSIVRRCMIQREQSKTANKTE
>gnl|bcl2dbpro|A0A3S2PV78_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias javanicus GN=BCL-2 (length=186 residues).
MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSGGIGKSIAIECF
RQGAFITLVARDEVVLCVSVDISSDYTQVENVIKQAQEKLGPVDMLVNCAGTAVAGKFEEMEVERFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKTANKTE
>gnl|bcl2dbpro|A0A437D660_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias javanicus GN=BCL2L1 (length=231 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAEEVGEEQSTETHANGTFNGTSPGTPPLSPLRQQQLPPSTTNMD
AVKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVD
RIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFIAQKRL
>gnl|bcl2dbpro|A0A437D660_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias javanicus GN=BCL2L1 (length=253 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAEEVGEEQSTETHANGTFNGTSPGTPPLSPLRQQQLPPSTTNMD
AVKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVD
RIVEWMTVYLDNHIQPWIQSQGGWLLPEHQLLMRDIKPAAPQRHTHERFAEIFGQEAAAESRRSQESFKKWLLVGMTVAT
GVLVGSFIAQKRL
>gnl|bcl2dbpro|A0A437DD16_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias javanicus GN=BCL2L1 (length=216 residues).
MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQTEEDRSAVCNGTLVNSEDDQLKKSCPCCNSMDAIKSTLKDSADEF
ERRFYQGFSDLSVQLHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVECVERNMSELVSRIAEWMTMYLDEQ
ISPWIHSQGGWDCFARLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLIAKK
© 1998-2020Legal notice