Dataset for protein BCL-2-like of organism Oryzias javanicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3S2PV78_BCL2-02      ---------------------------MLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-03      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
A0A3S2PV78_BCL2-04      MSSKEGFSSAVTDWLFINSWWILLPFIMLLIVVAFIVAFVLLLYMISPLI
A0A437DD16_BCL2L1-      ---------------------------------MSHCNRELVQFYLGYKM
A0A3S2PV78_BCL2-01      --------------------------------MANVSHRSIVEKYICHKL
A0A437D660_BCL2L1-      ----------------------------------MSRNRELVVFYVKYKL
A0A437D660_BCL2L1-      ----------------------------------MSRNRELVVFYVKYKL
                                                                ::   :   :

A0A3S2PV78_BCL2-02      SPKPLKLNGAHVVVTGGSGG---IGKSIAIECFRQGAFITLVARDEDKLL
A0A3S2PV78_BCL2-03      SPKPLKLNGAHVVVTGGSGG---IGKSIAIECFRQGAFITLVARDEDKLL
A0A3S2PV78_BCL2-04      SPKPLKLNGAHVVVTGGSGG---IGKSIAIECFRQGAFITLVA-------
A0A437DD16_BCL2L1-      SSRDYPVSLLKPTDDGGQT-------EEDRSAVCNGTLVNSED-------
A0A3S2PV78_BCL2-01      SKRGYVFG---------------LDGGQHEDAANNGSLGDRSPTPVRRRC
A0A437D660_BCL2L1-      SQRNYPLNHIVLNESPNRTAAEEVGEEQSTETHANGTFNGTSP-------
A0A437D660_BCL2L1-      SQRNYPLNHIVLNESPNRTAAEEVGEEQSTETHANGTFNGTSP-------
                        * .   ..                      .   :*::            

A0A3S2PV78_BCL2-02      KAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKL--------
A0A3S2PV78_BCL2-03      KAKKEVEKFAINDKQVVLCVSVDISSDYTQVENVIKQAQEKL--------
A0A3S2PV78_BCL2-04      ------R------DEVVLCVSVDISSDYTQVENVIKQAQEKL--------
A0A437DD16_BCL2L1-      ---------------DQLKKSCPCCNSMDAIKSTLKDSADEFERRFYQGF
A0A3S2PV78_BCL2-01      DAGTGP-------DGERSPRLIRALEPHADIHRVLREAGDELERLYQRDF
A0A437D660_BCL2L1-      --GTPPL------SPLRQQQLPPSTTNMDAVKEALRDTANEFELRYALAF
A0A437D660_BCL2L1-      --GTPPL------SPLRQQQLPPSTTNMDAVKEALRDTANEFELRYALAF
                                                      :  .:.:: :::        

A0A3S2PV78_BCL2-02      GPVDMLVNCAGTAVAGKFEEMEVERFK-ELMEVNYLGSVYPTRA----VI
A0A3S2PV78_BCL2-03      GPVDMLVNCAGTAVAGKFEEMEVERFK-ELMEVNYLGSVYPTRA----VI
A0A3S2PV78_BCL2-04      GPVDMLVNCAGTAVAGKFEEMEVERFKIVTMGLFRTIALFYLGSFDSIVR
A0A437DD16_BCL2L1-      SDLSVQLHITPDTAYQNFKSVLDELFK-DGINWGRVVGLFVFGG--VLCV
A0A3S2PV78_BCL2-01      TEMSRQLYLTSTTAKTRFAEVIDELFR-DGVNWGRIIAFFEFGG--TVCV
A0A437D660_BCL2L1-      NNLHSQLHITPATAYQSFENVMNELFR-DNINWGRIVGLFAFGG--ALCV
A0A437D660_BCL2L1-      NNLHSQLHITPATAYQSFENVMNELFR-DNINWGRIVGLFAFGG--ALCV
                          :   :  :  :.   * .:  * *.   :      ..:   .      

A0A3S2PV78_BCL2-02      TTMKERRMGRIVFVSSQ------FALRGLAESLQMEMKPYNIYVTVAFPP
A0A3S2PV78_BCL2-03      TTMKERRMGRIVFVSSQAGQIGLFGYTAYSPSSLLCMKPYNIYVTVAFPP
A0A3S2PV78_BCL2-04      RCMIQREQSKTA--------------------------------------
A0A437DD16_BCL2L1-      ECV-ERNMSELV--------------------------------------
A0A3S2PV78_BCL2-01      ECASDEEMSAQV--------------------------------------
A0A437D660_BCL2L1-      ECV-EKEMSPLV--------------------------------------
A0A437D660_BCL2L1-      ECV-EKEMSPLV--------------------------------------
                            :   .  .                                      

A0A3S2PV78_BCL2-02      DTDTPLLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSV
A0A3S2PV78_BCL2-03      DTDTPLLAEENKSKPLETKLISETSGVWQPDQVAKVFVKDAVQGNFNSSV
A0A3S2PV78_BCL2-04      ----------NKTE------------------------------------
A0A437DD16_BCL2L1-      ----------SRIAEWMTMYLDEQISPWIHSQ------------------
A0A3S2PV78_BCL2-01      ----------ASIAEWMTEYLNGPLNSWIEDN------------------
A0A437D660_BCL2L1-      ----------DRIVEWMTVYLDNHIQPWIQSQ------------------
A0A437D660_BCL2L1-      ----------DRIVEWMTVYLDNHIQPWIQSQ------------------
                                                                          

A0A3S2PV78_BCL2-02      GPDGYMLSALTCGMSPVTSITEGLQQ-DAFVELYDRQKETVFSCYWPSIK
A0A3S2PV78_BCL2-03      GPDGYMLSALTCGMSPVTSITEGLQQ-IVTMGLF----------------
A0A3S2PV78_BCL2-04      --------------------------------------------------
A0A437DD16_BCL2L1-      --GGW----------------------DCFARLYGQDGAAEARRFQETLK
A0A3S2PV78_BCL2-01      --GGW----------------------DAFVELYDRQKETVFSCYWPSIK
A0A437D660_BCL2L1-      --GGW----------------------ERFAEIFGQEAAAESRRSQESFK
A0A437D660_BCL2L1-      --GGWLLPEHQLLMRDIKPAAPQRHTHERFAEIFGQEAAAESRRSQESFK
                                                                          

A0A3S2PV78_BCL2-02      TVFGLAALGAASLTIGAYLAQK----------
A0A3S2PV78_BCL2-03      RTIALFYLGSFDSIVRRCMIQREQSKTANKTE
A0A3S2PV78_BCL2-04      --------------------------------
A0A437DD16_BCL2L1-      KWTLVAVALLTGLLLGLLIAKK----------
A0A3S2PV78_BCL2-01      TVFGLAALGAASLTIGAYLAQK----------
A0A437D660_BCL2L1-      KWLLVGMTVATGVLVGSFIAQKRL--------
A0A437D660_BCL2L1-      KWLLVGMTVATGVLVGSFIAQKRL--------
                                                        

© 1998-2020Legal notice