Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      .                         
---------------------------------------------g----maapavasgqprllaae-------------
mahagrtgydnreivmkyihyklsqrgymwslrrnavimlnsylg-sgqkastgglvpsaqassrprkeaaarlevggge
      msqs   l vdfls     kmaefdqfsdveegfalqgf pflgkqsasalnptkkpaddy             
                            s         nrteapa daga-ggd sfeene mvtcg             
                                            e t pe m    i r r whptf             
                                                   e    e d a     d             
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
agaviggspgasppaalapdarrvarpapigaelpdvsatparllylaptrraspleemeapaadaimspeeeldgyepe
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------pa-rtglppspale-
plakrpavlplldlvgeaskvpstdgslpstpppaeeeedelyrqsleilkyvhtlqqdyllyal--p-qspgsrktaag
                                                 fgrylrraktgvcdikktgqprsaapsssra
                                                 ve  kle ag ckgrd mapeptrhi leq 
                                                 ia         a a s gvnaaq  t ehd 
                                                 a              g  t g    n     
                                                                e               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :.      .                                                          
------------tLrqagdsfqr---------------------------------------------------------
palspvppvvhlvmqrvtllvsqeveealqpylhnvpvasvetartifnqvmekefedgvinwgrivtifafegvlakkl
revi mta kq r  nsrfgtek                                                         
            a  e atei t                                                         
               c   dl l                                                         
               a   q                                                            
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        .                        :   ::  *      
---------------------------------------rhrqyfksqrislhltppdeiet-eevikelFqdGvv--wg
lqeqavpdvdtfksipyfvaefitrrmgewirqnggwviayeraqsgmssqifismghavqsfarivedilsq knln--
                                       nfwtd qellrk-d-knftdrkrlst mvhrr pt s  
                                       v  pn adytg- -vy esryglatq cna     hd    
                                           f  v aa       n q      ad            
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *                   :           :                .                       
riv---cF--------ghmdmvklasaemissvpktawwitqylesdtrewiqatgGw----------------------
---affs ipryrlqsngvvckesvnrdeepllerlsenmhtpsnrhlhtealkqraladkspwisgclctsrratpgah
 v tlie agtlldrgpafmaqhvkrinqsvcidpivlslvev vttked lvdnd h                      
     vt         aplttes rk- iardcsnvqal cdr agqhap  hs                          
      a           al  r ndn      qq     aa   d   g   e                          
                   c      k      g               a                              
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------d------------------------------gfvelylqr-cl----------------------sfrtvllp
sltegsatlifmpglgreepsaqgrlfdrdgnrlgrgr--ydffgvevr-esqgfcwnekigraalpyttalgv-eqfsl
       mqmsre y           lsle g      tyc-t-htsldeqqwr          rksrfiwvainrfica
       a                              ss-v-l-pqha twh           pernssqk--kn----
                                      e ts  snpap rha             dfkgcerlg-wttt
                                      a ap  rln l af               ega clga r gg
                                         a   dl    e               d   ahc  l  c
                                             ak                                 

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fvava---------lvvlgaayl-k-------------------------------------------------------
ql-lgdtdmsvdevv-taasvsai-alnsslhvfrmtdfcsassehsashgkerldlrgktqktddgsqlvlqkefpvnc
aap-dtpaw g qg-yld-l-l-ar                                                       
--gt-        agig-t-yfssp                                                       
ltti         rcl-wrrs-rrl                                                       
hmka         l fivf ligk                                                        
g            k  a   f ch                                                        
                       e                                                        

       650       660       670       680       690       700   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
---------------------------------------------------------------
fgtvegqkqskdvlpciyiiyeafshlevllyvlqwdlascqlqfepisfcigfcvqgnlvsl
                                                               
                                                               
                                                               
                                                               
                                                               
                                                               
© 1998-2022Legal notice