Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------g-lspdnrrlvad----------------------------------------
mamfslrrnavmglsqylgspqlmasa-r-ae---e-l--ekeaaarlevgggeagaviggspgasppaalapdarrvar
           ifanlgf gfgkkqhpalv--qtk-s-mk                                        
                       gmggpgtgypqemidce                                        
                         mtdaseqsaaa  vt                                        
                         a   m  r     ta                                        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
papigaelpdvsatparllylaptrraspleemeapaadaimspeeeldgyepeplakrpavlplldlvgeaskvpstdg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------f--y---q--y--d-----------------------------------r-pa-r-g
slpstpppaeeeedelyrqsleiyly-kls-rg-lw-qfsdveenrteapagdagaasapgvfssqpapaapal--p-t-
                       -ihvhtlaqdgely             e tgpemet saingn  whpa-kktgqps
                       igs lrr kt vcs                                   id mapep
                       gar   e a  skg                                   ds gvnaa
                        vk        c a                                    g  t g 
                         g        a                                      e      
                         e                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         *: ::  
pppspala-------------tlr-agd-fqrryrrafq-mlsqlhvtpvsaaksfarvveelfsdgvn--wgRivaifa
-gs-k-a-gpalspvppvvhlv--rv--s----he---spy--nvpiasghtvrrsstqmvkv-r----in-- vrtfss
sa-r-t-rarevi mta kq -mqq-tfgvsqn--tdl-g-srmadlknfegrqtllqaemhqe-edgvls   l  lie
l-hpssse             a  n ateietevwen aelthk-aayaeddyglifn claklfr pt         vt
t at lhq                e   dl lvf qf  d rg- --   trqe at  an   q  hd           
q  n e d                c   q      p   v aa       n i   e   d                   
                        a                                                       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :                                                           
f--------ggvlakrlltremeplvd-lae---wmteylnrhlr-wiq-nggw--------------------------
eagtlldrgealvcvesvsqq---d--ti--ipy--a--------t-l-qq---vikspwisgclctsrratpgahrqyq
         prfrqskvkqinqvs-ier-ks   sv-tvivttmhe -vk-r  ad                    slte
         apamtqh rnekasvccspfvl   fivdf tgrkgd  rdt                             
            t es nr- iar  qnvqa   llcar edqhep  hs                              
            c     kn      gq            a   ag   e                              
                  dk                         a   a                              
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        .       
--drfsiflsmpdeletee------------------------------------------------sesdtreellatg
ksqgivelygve-dits--iikdifqqgkvcfipryrlqsnhmdmvklasadeisslpktswnihqp---svntvascfa
g atstasfhtsvarlfwrgfcwneki raaldnstakhcgrrfglhtka kvliafsviakrlrnstwvgiknwfttav
   e cv  ysrqrp erk                                           kaleggqhvf rtdflsm
   a     rpnlpa adh                                                 lerl ml  ggl
          naah   af                                                  al   f    d
          d                                                                     
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
glalvfmpGlg----------flrk-------------------------------------------------------
avdgi-tltaareepsaqgrlysirgnrlgrgrgyydtylqrclqqqgakpytialafreqicpqvpvddtdmsvdevly
-tgalvga yy          ld-lrgktqktddgsqlv lklfrvncfgtvfgqksskdvtpclyilytpfwhlevr i
tsmqsssw sv          r-sd          cp l  le ph     feaccqga fll ilaigeaas g ql  
siehmirv rl           rl-                                                       
 h  calh kf           ghe                                                       
      ae  e           ae                                                        
                       d                                                        

       570       580       590 
....:....|....:....|....:....|.
                               
-------------------------------
vlaaaslapqlqfepisfcigfcvqgnlvsl
ldrwslcsc                      
  q d a                        
                               
                               
                               
                               
© 1998-2022Legal notice