Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------agrtgydnrrlvvdylhyklsq-g-------------------------yewd---
mfslrrnaviglnlylggpglmah--avapsteeilmkgis-----r-lgaggggvappaerllaaekeaaar--cgqgs
                     gmmtp-ssqrlaanaatfvnly rgk                          lv-sgfe
                       ggdmmmfpa    ti ak   g p                           svaa d
                       a  glee          g                                 c     
                           a            e                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  *                                             
--------------------------pa----rdPavrtspp------------------------------------pp
agavnrtsppastpgamstpsvrvsq--paapas ga-egtarllylaptrraspleemeapaadaimspeeeldgyest
dveeiggeagegpgpvlepdgrisgr  wipael m-satsg                                    hs
            daaefaa aafnan   hg dk dtpgpq                                     ar
            a   a                g  gn a                                       n
                                 e                                             e
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               .
paaa-----p---------------------------------------------------------------------t
sllqgpavs-vppvvheaskvpstdgslpstpppaeeeedelyrqsleiiarylreqatgakdakpmgragsasrkalla
kshkrrell mtdlkq                                                              ev
 e ea   i lla  g                                                                
   d                                                                            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:* ..  ..  .   *                    *   ::  *    ***:*::. *          .        : 
lRragdgfqrryrraFsgmssqlhitpghavqsfarVveelfsdGvn--WGRiVaffsF-------ggavcvesvnr-em
m qvatevstnhetd qellrk-dlknfddrkrlst mvhvlrr ptln   v tlie agtlldr-avmvaqrlsknnq
  e   dlelvfwqn adytg- --y etryglatq cna   h- s       vt         pplttklkrsi i
  c   q      pf  v ra   v   s qe  e  ad       d          a          ffakhh ki   
  a                a        n i                                            d    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :   :   *      *:    **                                           :  :    
eplverlaewmttyLnrhlrtWiqkqgGW-----------------------------------------dgfvefygve
sscidpivlsivev vttkhd lvdnr  adkspwisgclctsrratpgahsltegsatssaslysaqhreawtvlfhns
avdcsnvqallcdr egqhep  hst                                            at hg cwtr
 r  qq     aa  ad  ag   e                                              e ca  rpp
    g               a   a                                                     dn
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            :      .                                            
--------------r-l------svrtvllafvgvagvvtlgsly--k--------------------------------
ligraaldnslesa-r-srglwvginnwfstaaaigal-lw-a-fvsrmtdfcsassehsashgkerldlrgktqktddg
k        pttkwcprrfktqtrlkrl tlgs-t lkiavt-y-sr-                                
d        d afvage efshslfakf ig mvl kcggnsrvlril                                
         a  eh a  d geeka     c lt    f g lfhlh                                 
                      a               a a  a gf                                 
                                             ae                                 

       490       500       510       520       530       540       550      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                            
----------------------------------------------------------------------------
sqlvlqkefpvncfgtvegqkqskdvlpciyiiyeafshlevllyvlrwdlascqlqfepisfcigfcvqgnlvsl
                                           a liq                            
                                                                            
                                                                            
                                                                            
                                                                            
© 1998-2020Legal notice