Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|G1T264_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L10 (length=187 residues).
MADALEERTARLLTDYLECCAREPGTPEPQPSTPEAAVLRCAATQLQRVHWPFFSVYRGYPGNRIELAARVAEAVLSDGH
DLSWGRVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQRLVALLCARLAGQHRAWLQAQGGWDGFCVFYRTPLPLTFWR
RLLVRTFLSCFVATALLFAWTRVYREL
>gnl|bcl2dbpro|G1T2Q0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=MCL-1 (length=352 residues).
MAMFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPGASPPAALAPDARRVAR
PAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDG
SLPSTPPPAEEEEDELYRQSLEIIARYLREQATGAKDAKPMGRAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEF
FHVEDLESGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1T2Q0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=MCL-1 (length=197 residues).
MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLATGAKDAKPMGRAGSASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1TV33_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAANPLHQAMRAAGDEFETRFRQNFSDLAAQLHVTPGSAQQSFT
QVCDELFQRGPNWGRVVAFFAFGAALCAESVNKEMEPLVGQVQEWMVTYLETQLAGWIHSTGGWAEFTALYGDRALEEAR
RLREGTWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G1TW27_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL-2 (length=389 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGPALSPVPPVV
HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNI
ALWMTEYLNRHLHTWIQDNGGWADKSPWISGCLCTSRRATPGAHSLTEGSATSSASLYSAQHREAWHGFCWNEKIGRAAL
DNSTAKHCGRRFGLHTKAAKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGKERLDLRGKTQKTDDGSQLVLQK
EFPVNCFGTVEGQKQSKDVLPCIYIIYEAFSHLEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNLVSL
>gnl|bcl2dbpro|G1TW27_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL-2 (length=226 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGPALSPVPPVV
HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNI
ALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLSDFSWVSLKTLFSLALIGACITLGAYLGHK
>gnl|bcl2dbpro|Q9MYW4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPADSPAVNGATGHSSSLDAREV
IPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEME
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice