Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9CRQ4_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-------------AGDAGA
A0A5F9CRQ4_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-------------AGDAGA
Q9MYW4_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPE
G1T2Q0_MCL1-01          --------------------------MAMFSLRRNAVIGLNLYLGGPGLG
A0A5F9CXI7_BCL2A1-      --------------------------------------MFASQGFGSFQK
A0A5F9CXI7_BCL2A1-      --------------------------------------MFASQGFGSFQK
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          ----------------------------MFSLRRNAVIGLNLYLGGPGLG
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      ASAPGVFSSQPAPAAPR---------------------------------
A0A5F9CRQ4_BCL2-01      ASAPGVFSSQPAPAAPR---------------------------------
Q9MYW4_BCL2L1-01        METPSAINGNPAWHPAD---------------------------------
G1T2Q0_MCL1-01          AGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPGASPPAALAPD
A0A5F9CXI7_BCL2A1-      KQSPALLSEQQKMSDCE---------------------------------
A0A5F9CXI7_BCL2A1-      KQSPALLSEQQKMSDCE---------------------------------
A0A5F9CXI7_BCL2A1-      MAAAAAVSGAKRSLRAE---------------------------------
A0A5F9CXI7_BCL2A1-      MAAAAAVSGAKRSLRAE---------------------------------
G1T2Q0_MCL1-02          AGGGGVAPPAERLLATG---------------------------------
G1T264_BCL2L10-01       -MADALEERTARLLTDY---------------------------------
G1TV33_BCL2L2-01        MATPASAPDTRALVADF---------------------------------
                            .                                             

A0A5F9CRQ4_BCL2-02      --------------------------------------------------
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          ARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADAIMSP
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      --------------------------------------------------
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          EEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDGSLPSTPPPAEEEED
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      ------------------------DPAARTSPPPPPAAAGPALSPVPPVV
A0A5F9CRQ4_BCL2-01      ------------------------DPAARTSPPPPPAAAGPALSPVPPVV
Q9MYW4_BCL2L1-01        ------------------------SPAVNGATGHSSSLDAREVIPMTAVK
G1T2Q0_MCL1-01          ELYRQSLEIIARYLREQATGAKDAKPMGRAGSASRKALE-----------
A0A5F9CXI7_BCL2A1-      ---------FGYVHTLAQDYLLYILKTPQPGLGPSKTSR-----------
A0A5F9CXI7_BCL2A1-      ---------FGYVHTLAQDYLLYILKTPQPGLGPSKTSR-----------
A0A5F9CXI7_BCL2A1-      ---------LK------------------QRLRAISAEE-----------
A0A5F9CXI7_BCL2A1-      ---------LK------------------QRLRAISAEE-----------
G1T2Q0_MCL1-02          ---------AK-----------DAKPMGRAGSASRKALE-----------
G1T264_BCL2L10-01       ---------LE---------CCAREPGTPEPQPSTPEAA-----------
G1TV33_BCL2L2-01        ---------VGY-KLRQKGYVCGAGPG--EGPAANPLHQ-----------
                                                                          

A0A5F9CRQ4_BCL2-02      HLTLRQAGDDFSR-------------------------------------
A0A5F9CRQ4_BCL2-01      HLTLRQAGDDFSR-------------------------------------
Q9MYW4_BCL2L1-01        Q-ALREAGDEFEL-------------------------------------
G1T2Q0_MCL1-01          --TLRRVGDGVQR-------------------------------------
A0A5F9CXI7_BCL2A1-      --VLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQVMEKEFEDGV
A0A5F9CXI7_BCL2A1-      --VLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQVMEKEFEDGV
A0A5F9CXI7_BCL2A1-      --RLRQSRLLTQK-------------------------------------
A0A5F9CXI7_BCL2A1-      --RLRQSRLLTQK-------------------------------------
G1T2Q0_MCL1-02          --TLRRVGDGVQR-------------------------------------
G1T264_BCL2L10-01       --VLRCAATQLQR-------------------------------------
G1TV33_BCL2L2-01        --AMRAAGDEFET-------------------------------------
                           :.      .                                      

A0A5F9CRQ4_BCL2-02      --------------------------------------------------
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
A0A5F9CXI7_BCL2A1-      INWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEW
A0A5F9CXI7_BCL2A1-      INWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEW
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      ---------RYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVN--WG
A0A5F9CRQ4_BCL2-01      ---------RYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVN--WG
Q9MYW4_BCL2L1-01        ---------RYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVN--WG
G1T2Q0_MCL1-01          ---------NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT-NWG
A0A5F9CXI7_BCL2A1-      IRQNGGWVIAHRQYQKSQRISIFLSMPDEIET-EEIIKDIFQQGKV----
A0A5F9CXI7_BCL2A1-      IRQNGGWVIAHRQYQKSQRISIFLSMPDEIET-EEIIKDIFQQGKV----
A0A5F9CXI7_BCL2A1-      -------VIAHRQYQKSQRISIFLSMPDEIET-EEIIKDIFQQGKV----
A0A5F9CXI7_BCL2A1-      -------VIAHRQYQKSQRISIFLSMPDEIET-EEIIKDIFQQGKV----
G1T2Q0_MCL1-02          ---------NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT-NWG
G1T264_BCL2L10-01       ---------VHWPFFSVYRG----YPGNRIELAARVAEAVLSDGHDLSWG
G1TV33_BCL2L2-01        ---------RFRQNFSDLAAQLHVTPGSAQQSFTQVCDELFQRGPN--WG
                                  .                        :   ::  *      

A0A5F9CRQ4_BCL2-02      RIVAFFEF--------GGVMCVESVNREMSPLVDNIALWMTEYLNRHLHT
A0A5F9CRQ4_BCL2-01      RIVAFFEF--------GGVMCVESVNREMSPLVDNIALWMTEYLNRHLHT
Q9MYW4_BCL2L1-01        RIVAFFSF--------GGALCVESVDKEMEVLVSRIAAWMATYLNDHLEP
G1T2Q0_MCL1-01          RIVTLISF--------GAFVAKHLKSINQESCIEPLAESITDVLVRTKRD
A0A5F9CXI7_BCL2A1-      ------CFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTRE
A0A5F9CXI7_BCL2A1-      ------CFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTRE
A0A5F9CXI7_BCL2A1-      ------CFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTRE
A0A5F9CXI7_BCL2A1-      ------CFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTRE
G1T2Q0_MCL1-02          RIVTLISF--------GAFVAKHLKSINQESCIEPLAESITDVLVRTKRD
G1T264_BCL2L10-01       RVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQRLVALLCARLAGQHRA
G1TV33_BCL2L2-01        RVVAFFAF-------GAALCAESVNK-EMEPLVGQVQEWMVTYLETQLAG
                               *                   :           :          

A0A5F9CRQ4_BCL2-02      WIQDNGGWADKSPWISGCLCTSRRATPGAHSLTEGSAT------------
A0A5F9CRQ4_BCL2-01      WIQDNGGW-----------------------------D------------
Q9MYW4_BCL2L1-01        WIQENGGW-----------------------------D------------
G1T2Q0_MCL1-01          WLVKQRGW-----------------------------D------------
A0A5F9CXI7_BCL2A1-      EALATGGL-----------------------------DLIFMPGLG----
A0A5F9CXI7_BCL2A1-      EALATDAH-----------------------------MQMSREGYGREEP
A0A5F9CXI7_BCL2A1-      EALATGGL-----------------------------DLIFMPGLG----
A0A5F9CXI7_BCL2A1-      EALATGGL-----------------------------DLIFMPGLG----
G1T2Q0_MCL1-02          WLVKQRGW-----------------------------D------------
G1T264_BCL2L10-01       WLQAQGGW-----------------------------D------------
G1TV33_BCL2L2-01        WIHSTGGW-----------------------------A------------
                              .                                           

A0A5F9CRQ4_BCL2-02      ------------------SSASLYSAQHREAWHGFCWNEKIGRAALDNST
A0A5F9CRQ4_BCL2-01      ------------------AFVELYGPSVR---------------PLSDFS
Q9MYW4_BCL2L1-01        ------------------TFVELYGNNAA---------------AESRKG
G1T2Q0_MCL1-01          ------------------GFVEFFHVE-DLES------------------
A0A5F9CXI7_BCL2A1-      ------FDRDGNRLGRGRGYYDTYLQR-CLQQQG----------AKPYTI
A0A5F9CXI7_BCL2A1-      SAQGRLFSLEGGR------------QK-C---------------------
A0A5F9CXI7_BCL2A1-      ------L-------------CPLLLLL-LLRH--------------PFFA
A0A5F9CXI7_BCL2A1-      ------FDRDGNRLGRGRGYYDTYLQR-CLQQQG----------AKPYTI
G1T2Q0_MCL1-02          ------------------GFVEFFHVE-DLES------------------
G1T264_BCL2L10-01       ------------------GFCVFYRTPLPLTFWR----------RL----
G1TV33_BCL2L2-01        ------------------EFTALYGDR-ALEEAR----------RLREGT
                                                                          

A0A5F9CRQ4_BCL2-02      AKHCGRRFGLHTKAA--------KVLIAFSVIAKKALNSSLHVFRMTDFC
A0A5F9CRQ4_BCL2-01      WVSLKTLFSLAL-IG--------ACITLGAYLGHK---------------
Q9MYW4_BCL2L1-01        QERFNRWFLTGMTVA--------GVVLLGSLFSRK---------------
G1T2Q0_MCL1-01          --GIRNVLLAFAGVA---------GVGAGLAYLIR---------------
A0A5F9CXI7_BCL2A1-      ALAFREQICPQVPVDDTDMSVDEVLYVDAAASLAP---------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      CCSGAEFTLPLLALGTPAWSGDQRLILLRASLC-----------------
A0A5F9CXI7_BCL2A1-      ALAFREQICPQVPVDDTDMSVDEVLYVDAAASLAP---------------
G1T2Q0_MCL1-02          --GIRNVLLAFAGVA--------GV-GAGLAYLIR---------------
G1T264_BCL2L10-01       --LVRTFLSCFVATA--------LLFAWTRVYREL---------------
G1TV33_BCL2L2-01        WASVRTVLTGAVALG--------ALVTVGAFFASK---------------
                                                                          

A0A5F9CRQ4_BCL2-02      SASSEHSASHGKERLDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQKQS
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      KDVLPCIYIIYEAFSHLEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNL
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      VSL
A0A5F9CRQ4_BCL2-01      ---
Q9MYW4_BCL2L1-01        ---
G1T2Q0_MCL1-01          ---
A0A5F9CXI7_BCL2A1-      ---
A0A5F9CXI7_BCL2A1-      ---
A0A5F9CXI7_BCL2A1-      ---
A0A5F9CXI7_BCL2A1-      ---
G1T2Q0_MCL1-02          ---
G1T264_BCL2L10-01       ---
G1TV33_BCL2L2-01        ---
                           

© 1998-2022Legal notice