Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1T2Q0_MCL1-01         --------------------------MAMFSLRRNAVIGLNLYLGGPGLG
G1TW27_BCL2-02         ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRG--
G1TW27_BCL2-01         ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRG--
Q9MYW4_BCL2L1-01       ---------------------------MSQSNRELVVDFLSYKLSQKG--
G1T2Q0_MCL1-02         MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLATGAK---------
G1T264_BCL2L10-01      -----------------------MADALEERTARLLTDYLE---------
G1TV33_BCL2L2-01       ----------------------MATPASAPDTRALVADFVGYKLRQKG--
                                                                         

G1T2Q0_MCL1-01         AGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIGGSPGASPPAALAPD
G1TW27_BCL2-02         -----------------------YEWDAGDAGA-------ASAPGVFS--
G1TW27_BCL2-01         -----------------------YEWD-------------AGDAGAASAP
Q9MYW4_BCL2L1-01       -----------------------YSWSQFSDVEENRTEAPEGTGPEMETP
G1T2Q0_MCL1-02         --------------------------D-----------------------
G1T264_BCL2L10-01      ------------------------CCA-----------------------
G1TV33_BCL2L2-01       -----------------------YVCG-----------------------
                                                                         

G1T2Q0_MCL1-01         ARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADAIMSP
G1TW27_BCL2-02         ----SQPAPAAPRDPAARTSPP----------------------------
G1TW27_BCL2-01         GVFSSQPAPAAPRDPAARTSPP----------------------------
Q9MYW4_BCL2L1-01       SAINGNPAWHPADSPAVNGATG----------------------------
G1T2Q0_MCL1-02         ------------AKPMGRAGSA----------------------------
G1T264_BCL2L10-01      ------------REPGTPEPQP----------------------------
G1TV33_BCL2L2-01       ------------AGPG--EGPA----------------------------
                                     *                                   

G1T2Q0_MCL1-01         EEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDGSLPSTPPPAEEEED
G1TW27_BCL2-02         --------PPPAAAGPALSPVPPVVH------------------------
G1TW27_BCL2-01         --------PPPAAAGPALSPVPPVVH------------------------
Q9MYW4_BCL2L1-01       --------HSSSLDAREVIPMTAVKQ------------------------
G1T2Q0_MCL1-02         --------SRKALE------------------------------------
G1T264_BCL2L10-01      --------STPEAA------------------------------------
G1TV33_BCL2L2-01       --------ANPLHQ------------------------------------
                                                                         

G1T2Q0_MCL1-01         ELYRQSLEIIARYLREQATGAKDAKPMGRAGSASRKALETLRRVGDGVQR
G1TW27_BCL2-02         --------------------------------------LTLRQAGDDFSR
G1TW27_BCL2-01         --------------------------------------LTLRQAGDDFSR
Q9MYW4_BCL2L1-01       ---------------------------------------ALREAGDEFEL
G1T2Q0_MCL1-02         ---------------------------------------TLRRVGDGVQR
G1T264_BCL2L10-01      ---------------------------------------VLRCAATQLQR
G1TV33_BCL2L2-01       ---------------------------------------AMRAAGDEFET
                                                              .:* ..  .. 

G1T2Q0_MCL1-01         NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT-NWGRIVTLISF-
G1TW27_BCL2-02         RYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGV--NWGRIVAFFEF-
G1TW27_BCL2-01         RYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVN--WGRIVAFFEF-
Q9MYW4_BCL2L1-01       RYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVN--WGRIVAFFSF-
G1T2Q0_MCL1-02         NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT-NWGRIVTLISF-
G1T264_BCL2L10-01      VHWPFFSVYRG----YPGNRIELAARVAEAVLSDGHDLSWGRVVTLVTFA
G1TV33_BCL2L2-01       RFRQNFSDLAAQLHVTPGSAQQSFTQVCDELFQRGPN--WGRVVAFFAF-
                        .   *                    *   ::  *    ***:*::. * 

G1T2Q0_MCL1-01         ------GAFVAKHLKSI-NQESCIEPLAESITDVLVRTKRDWLVKQRGW-
G1TW27_BCL2-02         ------GGVMCVESVNR-EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWA
G1TW27_BCL2-01         ------GGVMCVESVNR-EMSPLVDNIALWMTEYLNRHLHTWIQDNGGW-
Q9MYW4_BCL2L1-01       ------GGALCVESVDK-EMEVLVSRIAAWMATYLNDHLEPWIQENGGW-
G1T2Q0_MCL1-02         -------GAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW-
G1T264_BCL2L10-01      GTLLDRGPPVTTQRVRRNEIARDCQRLVALLCARLAGQHRAWLQAQGGW-
G1TV33_BCL2L2-01       ------GAALCAESVNK-EMEPLVGQVQEWMVTYLETQLAGWIHSTGGW-
                                .        :       :   :   *      *:    ** 

G1T2Q0_MCL1-01         ----------------------------------------DGFVEFFHVE
G1TW27_BCL2-02         DKSPWISGCLCTSRRATPGAHSLTEGSATSSASLYSAQHREAWHGFCWNE
G1TW27_BCL2-01         ----------------------------------------DAFVELYGPS
Q9MYW4_BCL2L1-01       ----------------------------------------DTFVELYGNN
G1T2Q0_MCL1-02         ----------------------------------------DGFVEFFHVE
G1T264_BCL2L10-01      ----------------------------------------DGFCVFYRTP
G1TV33_BCL2L2-01       ----------------------------------------AEFTALYGDR
                                                                 :  :    

G1T2Q0_MCL1-01         D-------------------LESGIRNVLLAFAGVAGVGAG---------
G1TW27_BCL2-02         KIGRAALDNSTAKHCGRRFGLHTKAAKVLIAFSVIAKKALNSSLHVFRMT
G1TW27_BCL2-01         -------------VRPLSDFSWVSLKTLFSLAL-IGACITLGAYLGHK--
Q9MYW4_BCL2L1-01       -------------AAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK--
G1T2Q0_MCL1-02         ---------DLES----------GIRNVLLAFAGVAGV-GAGLAYLIR--
G1T264_BCL2L10-01      L--------PLTFWRRL------LVRTFLSCFVATALLFAWTRVYREL--
G1TV33_BCL2L2-01       ---------ALEEARRLREGTWASVRTVLTGAVALGALVTVGAFFASK--
                                                   :      .              

G1T2Q0_MCL1-01         --------------------------------------------------
G1TW27_BCL2-02         DFCSASSEHSASHGKERLDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQ
G1TW27_BCL2-01         --------------------------------------------------
Q9MYW4_BCL2L1-01       --------------------------------------------------
G1T2Q0_MCL1-02         --------------------------------------------------
G1T264_BCL2L10-01      --------------------------------------------------
G1TV33_BCL2L2-01       --------------------------------------------------
                                                                         

G1T2Q0_MCL1-01         ----------------------LAYLIR----------------------
G1TW27_BCL2-02         KQSKDVLPCIYIIYEAFSHLEVLLYVLQWDLASCQLQFEPISFCIGFCVQ
G1TW27_BCL2-01         --------------------------------------------------
Q9MYW4_BCL2L1-01       --------------------------------------------------
G1T2Q0_MCL1-02         --------------------------------------------------
G1T264_BCL2L10-01      --------------------------------------------------
G1TV33_BCL2L2-01       --------------------------------------------------
                                                                         

G1T2Q0_MCL1-01         ------
G1TW27_BCL2-02         GNLVSL
G1TW27_BCL2-01         ------
Q9MYW4_BCL2L1-01       ------
G1T2Q0_MCL1-02         ------
G1T264_BCL2L10-01      ------
G1TV33_BCL2L2-01       ------
                             

© 1998-2020Legal notice