Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9CRQ4_BCL2-02      -----------------------MAHAGRTGYDNREIVMK----------
A0A5F9CRQ4_BCL2-01      -----------------------MAHAGRTGYDNREIVMK----------
Q9MYW4_BCL2L1-01        -----------------------------MSQSNRELVVD----------
G1T2Q0_MCL1-01          MAMFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEV
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      -----------MFASQGFGSFQKKQSPALLSEQQKMSDCE----------
A0A5F9CXI7_BCL2A1-      -----------MFASQGFGSFQKKQSPALLSEQQKMSDCE----------
G1T2Q0_MCL1-02          --MFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAT----------
G1T264_BCL2L10-01       -------------------------MADALEERTARLLTD----------
G1TV33_BCL2L2-01        ------------------------MATPASAPDTRALVAD----------
                                                                          

A0A5F9CRQ4_BCL2-02      --------------------------------------------------
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          GGGEAGAVIGGSPGASPPAALAPDARRVARPAPIGAELPDVSATPARLLY
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      --------------------------------------------------
A0A5F9CRQ4_BCL2-01      --------------------------------------------------
Q9MYW4_BCL2L1-01        --------------------------------------------------
G1T2Q0_MCL1-01          LAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLAKRPAVLPLLDLVG
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
G1T2Q0_MCL1-02          --------------------------------------------------
G1T264_BCL2L10-01       --------------------------------------------------
G1TV33_BCL2L2-01        --------------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      ---------------------------------YIHYKLSQRGYEWD---
A0A5F9CRQ4_BCL2-01      ---------------------------------YIHYKLSQRGYEWD---
Q9MYW4_BCL2L1-01        ---------------------------------FLSYKLSQKGYSWSQFS
G1T2Q0_MCL1-01          EASKVPSTDGSLPSTPPPAEEEEDELYRQSLEIIARYLREQATGAKD---
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      ---------------------------------FGYVHTLAQDYLLY---
A0A5F9CXI7_BCL2A1-      ---------------------------------FGYVHTLAQDYLLY---
G1T2Q0_MCL1-02          ---------------------------------GAK----------D---
G1T264_BCL2L10-01       ---------------------------------YLE--------CCA---
G1TV33_BCL2L2-01        ---------------------------------FVGYKLRQKGYVCG---
                                                                          

A0A5F9CRQ4_BCL2-02      ----------AGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGP
A0A5F9CRQ4_BCL2-01      ----------AGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGP
Q9MYW4_BCL2L1-01        DVEENRTEAPEGTGPEMETPSAINGNPAWHPADSPAVNGATGHSSSLDAR
G1T2Q0_MCL1-01          --------------------------------AKPMGRAGSASRKALE--
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------ILKTPQPGLGPSKTSR--
A0A5F9CXI7_BCL2A1-      --------------------------------ILKTPQPGLGPSKTSR--
G1T2Q0_MCL1-02          --------------------------------AKPMGRAGSASRKALE--
G1T264_BCL2L10-01       --------------------------------REPGTPEPQPSTPEAA--
G1TV33_BCL2L2-01        --------------------------------AGPG--EGPAANPLHQ--
                                                                          

A0A5F9CRQ4_BCL2-02      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVV
A0A5F9CRQ4_BCL2-01      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVV
Q9MYW4_BCL2L1-01        EVIPMTAVKQ-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
G1T2Q0_MCL1-01          -----------TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A5F9CXI7_BCL2A1-      ---------------------------------MAAAAAVSGAKRSLRAE
A0A5F9CXI7_BCL2A1-      ---------------------------------MAAAAAVSGAKRSLRAE
A0A5F9CXI7_BCL2A1-      -----------VLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQV
A0A5F9CXI7_BCL2A1-      -----------VLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQV
G1T2Q0_MCL1-02          -----------TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
G1T264_BCL2L10-01       -----------VLRCAATQLQRVHWPFFSVYRG----YPGNRIELAARVA
G1TV33_BCL2L2-01        -----------AMRAAGDEFETRFRQNFSDLAAQLHVTPGSAQQSFTQVC
                                                                          

A0A5F9CRQ4_BCL2-02      EELFRDGVN--WGRIVAFFEF--------GGVMCVESVNREMSPLVDNIA
A0A5F9CRQ4_BCL2-01      EELFRDGVN--WGRIVAFFEF--------GGVMCVESVNREMSPLVDNIA
Q9MYW4_BCL2L1-01        NELFRDGVN--WGRIVAFFSF--------GGALCVESVDKEMEVLVSRIA
G1T2Q0_MCL1-01          VHVFSDGVT-NWGRIVTLISF--------GAFVAKHLKSINQESCIEPLA
A0A5F9CXI7_BCL2A1-      LKQ----------RLRAISAE--------ERLRQSRLLTQK---------
A0A5F9CXI7_BCL2A1-      LKQ----------RLRAISAE--------ERLRQSRLLTQK---------
A0A5F9CXI7_BCL2A1-      MEKEFEDGVINWGRIVTIFAF--------EGVLAKKLLQEQAVPDVDTFK
A0A5F9CXI7_BCL2A1-      MEKEFEDGVINWGRIVTIFAF--------EGVLAKKLLQEQAVPDVDTFK
G1T2Q0_MCL1-02          VHVFSDGVT-NWGRIVTLISF--------GAFVAKHLKSINQESCIEPLA
G1T264_BCL2L10-01       EAVLSDGHDLSWGRVVTLVTFAGTLLDRGPPVTTQRVRRNEIARDCQRLV
G1TV33_BCL2L2-01        DELFQRGPN--WGRVVAFFAF-------GAALCAESVNK-EMEPLVGQVQ
                                     *: ::                      :         

A0A5F9CRQ4_BCL2-02      L---WMTEYLNRHLHTWIQDNGGWADKSPWISGCLCTSRRATPGAHSLTE
A0A5F9CRQ4_BCL2-01      L---WMTEYLNRHLHTWIQDNGGW--------------------------
Q9MYW4_BCL2L1-01        A---WMATYLNDHLEPWIQENGGW--------------------------
G1T2Q0_MCL1-01          E---SITDVLVRTKRDWLVKQRGW--------------------------
A0A5F9CXI7_BCL2A1-      ------------------------VI------------------AHRQYQ
A0A5F9CXI7_BCL2A1-      ------------------------VI------------------AHRQYQ
A0A5F9CXI7_BCL2A1-      SIPYFVAEFITRRMGEWIRQNGGWVI------------------AHRQYQ
A0A5F9CXI7_BCL2A1-      SIPYFVAEFITRRMGEWIRQNGGWVI------------------AHRQYQ
G1T2Q0_MCL1-02          E---SITDVLVRTKRDWLVKQRGW--------------------------
G1T264_BCL2L10-01       A---LLCARLAGQHRAWLQAQGGW--------------------------
G1TV33_BCL2L2-01        E---WMVTYLETQLAGWIHSTGGW--------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      GSATSSASLYSAQHREAWHGFCWNEKIGRAALDNSTAKHCGRRFGLHTKA
A0A5F9CRQ4_BCL2-01      --DAFVELYGPSVRPLSDF-------------------------------
Q9MYW4_BCL2L1-01        --DTFVELYGNNAAAESRK-------------------------------
G1T2Q0_MCL1-01          --DGFVEFFHVE-DLES---------------------------------
A0A5F9CXI7_BCL2A1-      KSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLAS
A0A5F9CXI7_BCL2A1-      KSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLAS
A0A5F9CXI7_BCL2A1-      KSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLAS
A0A5F9CXI7_BCL2A1-      KSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLAS
G1T2Q0_MCL1-02          --DGFVEFFHVE-DLES---------------------------------
G1T264_BCL2L10-01       --DGFCVFYRTPLPLTFWR-------------------------------
G1TV33_BCL2L2-01        --AEFTALYGDR-ALEEAR-------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      AKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGKE---------
A0A5F9CRQ4_BCL2-01      -----------------SWVSLKTLFSLAL-IGACITLGAY---------
Q9MYW4_BCL2L1-01        -----------------GQERFNRWFLTGMTVAGVVLLGSL---------
G1T2Q0_MCL1-01          --------------------GIRNVLLAFAGVAGV-GAGLA---------
A0A5F9CXI7_BCL2A1-      ADEISSLPKTSWNIHQPSESDTREEALATGGLDLIFMPGLG---------
A0A5F9CXI7_BCL2A1-      ADEISSLPKTSWNIHQPSESDTREEALATGGLDLIFMPGLG---------
A0A5F9CXI7_BCL2A1-      ADEISSLPKTSWNIHQPSESDTREEALATGGLDLIFMPGLG---------
A0A5F9CXI7_BCL2A1-      ADEISSLPKTSWNIHQPSESDTREEALATDAHMQMSREGYGREEPSAQGR
G1T2Q0_MCL1-02          --------------------GIRNVLLAFAGVAGV-GAGLA---------
G1T264_BCL2L10-01       ------------RL------LVRTFLSCFVATALLFAWTRV---------
G1TV33_BCL2L2-01        ------------RLREGTWASVRTVLTGAVALGALVTVGAF---------
                                              .                           

A0A5F9CRQ4_BCL2-02      -RLDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQKQSKDVLPCIYIIYE
A0A5F9CRQ4_BCL2-01      -LGHK---------------------------------------------
Q9MYW4_BCL2L1-01        -FSRK---------------------------------------------
G1T2Q0_MCL1-01          -YLIR---------------------------------------------
A0A5F9CXI7_BCL2A1-      -FDRDGNRLGRGRGYYDTYLQRCLQQQGAKPYTIALAFREQICPQVPVDD
A0A5F9CXI7_BCL2A1-      -L-------------CPLLLLLLLRH----PFFACCSGAEFTLPLLALGT
A0A5F9CXI7_BCL2A1-      -FDRDGNRLGRGRGYYDTYLQRCLQQQGAKPYTIALAFREQICPQVPVDD
A0A5F9CXI7_BCL2A1-      LFSLEGGR------------QKC---------------------------
G1T2Q0_MCL1-02          -YLIR---------------------------------------------
G1T264_BCL2L10-01       -YREL---------------------------------------------
G1TV33_BCL2L2-01        -FASK---------------------------------------------
                                                                          

A0A5F9CRQ4_BCL2-02      AFSHLEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNLVSL
A0A5F9CRQ4_BCL2-01      -----------------------------------------
Q9MYW4_BCL2L1-01        -----------------------------------------
G1T2Q0_MCL1-01          -----------------------------------------
A0A5F9CXI7_BCL2A1-      TDMSVDEVLYVDAAASLAP----------------------
A0A5F9CXI7_BCL2A1-      PAWSGDQRLILLRASLC------------------------
A0A5F9CXI7_BCL2A1-      TDMSVDEVLYVDAAASLAP----------------------
A0A5F9CXI7_BCL2A1-      -----------------------------------------
G1T2Q0_MCL1-02          -----------------------------------------
G1T264_BCL2L10-01       -----------------------------------------
G1TV33_BCL2L2-01        -----------------------------------------
                                                                 

© 1998-2022Legal notice