Dataset for protein Bfl1 of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  ...*:*. *.  :.  :::          *: :* * * :  ..** ::                             
hmaaa a eg krifnaelekefedgvinwg ira f e gllakk  qekavpdvdtfksipyfvaefitrrmgewirq

       170       180       190       200       210       220       230       240

       250       260       270       280       290       300       310       320
***********..   :   * *          :                                              
           dahmqmsre y reepsaqgrll------lgrgrgy-----lll---qgak------------------
                                  sle g        cpll  k  rh     ffaccsga ftl llal

       330       340 
gtpaw g qr illr slc  
© 1998-2022Legal notice