Dataset for protein Bfl1 of organism Oryctolagus cuniculus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A5F9CXI7_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=188 residues).
MAAAAAVSGAKRSLRAELKQRLRAISAEERLRQSRLLTQKVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQGKVCF
IPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALATGGLDLIFMPGLGLCPLLLLLLLRHPFFACCSGA
EFTLPLLALGTPAWSGDQRLILLRASLC
>gnl|bcl2dbpro|A0A5F9CXI7_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=207 residues).
MAAAAAVSGAKRSLRAELKQRLRAISAEERLRQSRLLTQKVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQGKVCF
IPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALATGGLDLIFMPGLGFDRDGNRLGRGRGYYDTYLQR
CLQQQGAKPYTIALAFREQICPQVPVDDTDMSVDEVLYVDAAASLAP
>gnl|bcl2dbpro|A0A5F9CXI7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=283 residues).
MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQPGLGPSKTSRVLQNVTFSIQQEVEEALQPYL
HNVPVASVETARTIFNQVMEKEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEWIRQ
NGGWVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPS
ESDTREEALATDAHMQMSREGYGREEPSAQGRLFSLEGGRQKC
>gnl|bcl2dbpro|A0A5F9CXI7_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2A1 (length=331 residues).
MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQPGLGPSKTSRVLQNVTFSIQQEVEEALQPYL
HNVPVASVETARTIFNQVMEKEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFITRRMGEWIRQ
NGGWVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQGKVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPS
ESDTREEALATGGLDLIFMPGLGFDRDGNRLGRGRGYYDTYLQRCLQQQGAKPYTIALAFREQICPQVPVDDTDMSVDEV
LYVDAAASLAP
© 1998-2020Legal notice