Dataset for protein Bfl1 of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9CXI7_BCL2A1-      MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQP
A0A5F9CXI7_BCL2A1-      MFASQGFGSFQKKQSPALLSEQQKMSDCEFGYVHTLAQDYLLYILKTPQP
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
A0A5F9CXI7_BCL2A1-      --------------------------------------------------
                                                                          

A0A5F9CXI7_BCL2A1-      GLGPSKTSRVLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQVME
A0A5F9CXI7_BCL2A1-      GLGPSKTSRVLQNVTFSIQQEVEEALQPYLHNVPVASVETARTIFNQVME
A0A5F9CXI7_BCL2A1-      -------------------------------MAAAAAVSGAKRSLRAELK
A0A5F9CXI7_BCL2A1-      -------------------------------MAAAAAVSGAKRSLRAELK
                                                        ...*:*. *.  :.  ::

A0A5F9CXI7_BCL2A1-      KEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFI
A0A5F9CXI7_BCL2A1-      KEFEDGVINWGRIVTIFAFEGVLAKKLLQEQAVPDVDTFKSIPYFVAEFI
A0A5F9CXI7_BCL2A1-      Q----------RLRAISAEERLRQSRLLTQK-------------------
A0A5F9CXI7_BCL2A1-      Q----------RLRAISAEERLRQSRLLTQK-------------------
                        :          *: :* * * :  ..** ::                   

A0A5F9CXI7_BCL2A1-      TRRMGEWIRQNGGWVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQG
A0A5F9CXI7_BCL2A1-      TRRMGEWIRQNGGWVIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQG
A0A5F9CXI7_BCL2A1-      --------------VIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQG
A0A5F9CXI7_BCL2A1-      --------------VIAHRQYQKSQRISIFLSMPDEIETEEIIKDIFQQG
                                      ************************************

A0A5F9CXI7_BCL2A1-      KVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALA
A0A5F9CXI7_BCL2A1-      KVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALA
A0A5F9CXI7_BCL2A1-      KVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALA
A0A5F9CXI7_BCL2A1-      KVCFIPRYRLQSNHMDMVKLASADEISSLPKTSWNIHQPSESDTREEALA
                        **************************************************

A0A5F9CXI7_BCL2A1-      TDAHMQMSREGYGREEPSAQGRLFSLEGGR------------QKC-----
A0A5F9CXI7_BCL2A1-      TGGLDLIFMPGLG----------FDRDGNRLGRGRGYYDTYLQRCLQQQG
A0A5F9CXI7_BCL2A1-      TGGLDLIFMPGLG----------L-------------CPLLLLLLLRH--
A0A5F9CXI7_BCL2A1-      TGGLDLIFMPGLG----------FDRDGNRLGRGRGYYDTYLQRCLQQQG
                        *..   :   * *          :                          

A0A5F9CXI7_BCL2A1-      -----------------------------------------
A0A5F9CXI7_BCL2A1-      AKPYTIALAFREQICPQVPVDDTDMSVDEVLYVDAAASLAP
A0A5F9CXI7_BCL2A1-      --PFFACCSGAEFTLPLLALGTPAWSGDQRLILLRASLC--
A0A5F9CXI7_BCL2A1-      AKPYTIALAFREQICPQVPVDDTDMSVDEVLYVDAAASLAP
                                                                 

© 1998-2020Legal notice