Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  :. .            .              . :          .      .          
-----------------llsqngvle--mhygsgksspqnatgsskdssngivsngtpkrpnnlgvtstn----------
mtnflmskrnqctfidy-mprgretvgpswsprydvqqyr------rppslvrrdrpqsttdgra---rggyttkairdr
                 mf l cc s  llcinn tglrdnwetlcyklgh cmceilpdla gkmkfc           
                         h  ef ae  l fi           a  l  ehn i  a li a           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *                 :*    .  . .  .                 :.    :.  .:   :.
-------------LdgesdeeleretkllihsFlgdftglsqpqrketk----------alktmkrvvadvlekhryayn
eedgslpstpeyh wkgtlpstpeyl-----t nctsphtppaspsrsqqppsttdlda--ealrdtgweierryqrrfs
              ee qrllahdng  i    c     qa  q qa          vkam   lan f lq aa  d
               d   id  a                                                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.: . : :         .  * ..:. *   ****:*.:.** ..:.    *:  .                  : : ::
gminklslderhedmsfvgaVakslfaDhttNWGRiVsfvAFgavvsqhlkEkgrdncva-------------lvsqevs
nlhstflvtpgt---qsmsn mdevvg g-v    v glf  tgalcvkiv qkpsplpgqqqelgqepmscrrlvewit
d aqq hiqcapdycldlrk      r  hl               arecl  emgld v              ia tma
           eah e fef                                                            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ** .  . *: .:..*: *  :            :.  .:       ::    .                         
aYLlseqrdWivknnaWdgFvef------frvadpestvrnt------lmafagfagigatlalli--------------
v  gnhkqp lqsqgg er ckifgqsrsaesvssqestkkwewtkgkmfvittvvtqvvifl---rtrthsglrkkwrv
d  de ik   ld     aa    daav errqd im ev       lqgml nsgrsag kvrqnnlekdil     
           i                          f  a         a   gla l    rchkkk    f     
                                                        c       ia              

       330       340       350        
....:....|....:....|....:....|....:...
                                      
--------------------------------------
srhgddpqqaspnlrfwlvlsttqvtpvvnceehtgrq
             iplldmfl                 
             fl   a f                 
                                      
© 1998-2022Legal notice