Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A669C7T2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=278 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
>gnl|bcl2dbpro|A0A669C7T2_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=294 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTTREVEWTKGKMFQITLFNSQRSIFAKRCHNKKEKDIFFPFLLVFF
>gnl|bcl2dbpro|A0A669C7T2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=323 residues).
MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDR
EEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRTNTHSGLRKKWRVSRHGDDPQQASPNLLLWLMLSTTQVTPVVNCEEHT
GRQ
>gnl|bcl2dbpro|A0A669EYA1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L10 (length=231 residues).
MSRGGVTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLSFCCTSPHQAPPPPSESAAAMRR
LGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELG
QEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|I3IZK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oreochromis niloticus GN=BCL2L1 (length=232 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPLNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTDL
DAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|I3KXG5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis niloticus GN=MCL-1 (length=227 residues).
MFSLNCCLSEWCPNNDVGFIDNWETLCRKPGLVRRDGIHPTLDGAALISRNLEDGSLPSTPEETKLIIHSFLGDFTGLSQ
PQRKETKALKMMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSFVAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEKGR
DNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIVRNTLMAFAGFACIGATLALLIR
© 1998-2021Legal notice