Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A669C7T2_MCL1-02      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
A0A669C7T2_MCL1-03      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
A0A669C7T2_MCL1-01      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
A0A669EYA1_BCL2L10      ------------------MSRGGVTH--SLSAEGKTQLYR------RSPS
I3IZK7_BCL2L1-01        ------------------MSQNRELV--LFYIRYKLSQRN------YPLN
I3KXG5_MCL1-01          -----------------MFSLNCCLS--EWCPNNDVGFIDNWETLCRKPG
                                          :. .            .              .

A0A669C7T2_MCL1-02      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
A0A669C7T2_MCL1-03      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
A0A669C7T2_MCL1-01      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
A0A669EYA1_BCL2L10      AVCMCREQSDIAGRKMKFCG-----------------------LWKETLL
I3IZK7_BCL2L1-01        HIVLNEPLNRTDGGA---AG-----------------------LDEEQRI
I3KXG5_MCL1-01          LVRRDGIHPTLDGAALISRN-----------------------LEDGSLP
                         :          .      .                       *      

A0A669C7T2_MCL1-02      ELERETKLLIHSFLGDFTGLSQPQRKETK----------ALKTMKRVVAD
A0A669C7T2_MCL1-03      ELERETKLLIHSFLGDFTGLSQPQRKETK----------ALKTMKRVVAD
A0A669C7T2_MCL1-01      ELERETKLLIHSFLGDFTGLSQPQRKETK----------ALKTMKRVVAD
A0A669EYA1_BCL2L10      LAEDYL-----SFCCTSPHQAPPPPSESA------------AAMRRLGWD
I3IZK7_BCL2L1-01        DTHANG-----TFNGTSPGTPPASPQRQQQPPSTTDLDAVKEALRDTANE
I3KXG5_MCL1-01          STPEETKLIIHSFLGDFTGLSQPQRKETK----------ALKMMKRVVAD
                                   :*    .  . .  .                 :.    :

A0A669C7T2_MCL1-02      VLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFV
A0A669C7T2_MCL1-03      VLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFV
A0A669C7T2_MCL1-01      VLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFV
A0A669EYA1_BCL2L10      IERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLF
I3IZK7_BCL2L1-01        FELRYARAFSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGLF
I3KXG5_MCL1-01          VLEKHRYAYNGMINKLSLDERE---EDMSFVAKSLFGDHTTNWGRIVSFV
                        .  .:   :..: . : :         .  * ..:. *   ****:*.:.

A0A669C7T2_MCL1-02      AFGAVVSQHLKEKGRDNCVA-------------LVSQEVSAYLLSEQRDW
A0A669C7T2_MCL1-03      AFGAVVSQHLKEKGRDNCVA-------------LVSQEVSAYLLSEQRDW
A0A669C7T2_MCL1-01      AFGAVVSQHLKEKGRDNCVA-------------LVSQEVSAYLLSEQRDW
A0A669EYA1_BCL2L10      AFTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDW
I3IZK7_BCL2L1-01        AFGGALCVECVEKEMSPLVG-------------RIVEWMTVYLDNHIQPW
I3KXG5_MCL1-01          AFGAVVSQHLKEKGRDNCVV-------------LVSQEISAYLLSEQRDW
                        ** ..:.    *:  .                  : : :: ** .  . *

A0A669C7T2_MCL1-02      IVKNNAWDGFVEF------FRVADPESTVRNT------LMAFAGFAGIGA
A0A669C7T2_MCL1-03      IVKNNAWDGFVEF------FRVADPESTTREVEWTKGKMFQITLFNSQRS
A0A669C7T2_MCL1-01      IVKNNAWDGFVEF------FRVADPESTVRNT------LMAFAGFAGIGA
A0A669EYA1_BCL2L10      LLDNDGWEGFCKF---SRSAREVSQDSSMKKA------LFAAAGVGLAGL
I3IZK7_BCL2L1-01        IQSQGGWERFAEIFGQDAAAESRRSQESFKKW------LLVGMTVVTGVV
I3KXG5_MCL1-01          IIKNNAWDGFVAF------VRVADPESIVRNT------LMAFAGFACIGA
                        : .:..*: *  :            :.  .:       ::    .     

A0A669C7T2_MCL1-02      TLALLIRTNTHSGLRKKWRVSRHGDDPQQASPNLLLWLMLSTTQVTPVVN
A0A669C7T2_MCL1-03      IFAKRCHNKKEKDIF------------------FPFLLVFF---------
A0A669C7T2_MCL1-01      TLA----------LL------------------IRFWDALL---------
A0A669EYA1_BCL2L10      TFLLVR--------------------------------------------
I3IZK7_BCL2L1-01        AGALIAQKRL----------------------------------------
I3KXG5_MCL1-01          TLALLIR-------------------------------------------
                                                                          

A0A669C7T2_MCL1-02      CEEHTGRQ
A0A669C7T2_MCL1-03      --------
A0A669C7T2_MCL1-01      --------
A0A669EYA1_BCL2L10      --------
I3IZK7_BCL2L1-01        --------
I3KXG5_MCL1-01          --------
                                

© 1998-2021Legal notice