Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3JHR5_MCL1-02        MTNFLMSKRNQCTFIDYLLPQ---NGVLEGPMHYGSGKSSPQNATGSSKD
I3JHR5_MCL1-01        MTNFLMSKRNQCTFIDYLLPQ---NGVLEGPMHYGSGKSSPQNATGSSKD
I3JHR5_MCL1-03        MTNFLMSKRNQCTFIDYLLPQ---NGVLEGPMHYGSGKSSPQNATGSSKD
I3IZK7_BCL2L1-01      ---MSQNRELVLFYIRYKLSQ--RNYPLNHIVLNEPLNRTDGGAAGLDEE
I3KXG5_MCL1-01        -----------MFSLNCCLSEWCPNNDVGFIDNWETLCRK----PGLVRR
                                    :   *.:   *  :       .   .    .*    

I3JHR5_MCL1-02        SSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGE
I3JHR5_MCL1-01        SSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGE
I3JHR5_MCL1-03        SSNGIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGE
I3IZK7_BCL2L1-01      QRIDTHANGT---FNGT-----------------SPGTPPASPQ------
I3KXG5_MCL1-01        DGIHPTLDGAALISRNL-----------------EDGSLPSTPE------
                      .      :*:    ..                  . *: *::*:      

I3JHR5_MCL1-02        SDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLE-KHR
I3JHR5_MCL1-01        SDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLE-KHR
I3JHR5_MCL1-03        SDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLE-KHR
I3IZK7_BCL2L1-01      -------RQQ-------------QPPSTTDLDAVKEALRDTANEFELRYA
I3KXG5_MCL1-01        -------ETKLIIHSFLGDFTGLSQPQRKETKALKMMKRVVADVLE-KHR
                               :             . *. .: .*:*   * .*: :* .: 

I3JHR5_MCL1-02        YAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVV
I3JHR5_MCL1-01        YAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVV
I3JHR5_MCL1-03        YAYNGMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVV
I3IZK7_BCL2L1-01      RAFSDLHSQLHITPATAYQSF-ENVMDEVFRD-GVNWGRIVGLFAFGGAL
I3KXG5_MCL1-01        YAYNGMINKLSLDEREEDMSF---VAKSLFGDHTTNWGRIVSFVAFGAVV
                       *:..: .:* :       **   * ..:* *  .******.:.***..:

I3JHR5_MCL1-02        SQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADP
I3JHR5_MCL1-01        SQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADP
I3JHR5_MCL1-03        SQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADP
I3IZK7_BCL2L1-01      CVECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFG-QDA
I3KXG5_MCL1-01        SQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADP
                      .    **  .  *  : : ::.** .  . ** .:..*: *. :.   *.

I3JHR5_MCL1-02        ESTVRNT------LMAFAGFAGIGATL-------ALLIRTNTHSGLRKKW
I3JHR5_MCL1-01        ESTVRNT------LMAFAGFAGIGATL-------A----------LL---
I3JHR5_MCL1-03        ESTTREVEWTKGKMFQITLFNSQRSIF-------AKRCHNKKEKDIF---
I3IZK7_BCL2L1-01      AAESRRS------QESFKKWLLVGMTVVTGVVAGALIAQKRL--------
I3KXG5_MCL1-01        ESIVRNT------LMAFAGFACIGATL-------ALLIR-----------
                       :  *           :  :      .       *               

I3JHR5_MCL1-02        RVSRHGDDPQQASPNLLLWLMLSTTQVTPVVNCEEHTGRQ
I3JHR5_MCL1-01        ---------------IRFWDALL-----------------
I3JHR5_MCL1-03        ---------------FPFLLVFF-----------------
I3IZK7_BCL2L1-01      ----------------------------------------
I3KXG5_MCL1-01        ----------------------------------------
                                                              

© 1998-2020Legal notice