Dataset for protein Mcl-1 of organism Oncorhynchus tshawytscha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******:*******:***   ***** *  .:.****.  *** *********  ********* ****.**:****:*
MSLSKSItRATTTMLnFQNgvvGGSSYpA--gtsLYYFgetGAVrAGASPKSKVdtDLGNGTGDTpPRPTkLGvNVVKsN
       a       h   ---     l ddasp    d--   c         --         -    t  m    t 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**.***********   ******************* ****************.* *****: .* ****.********:
VLgNHLSDRSNNDDsdgSLPCTPQMASECGPELSNCqSGDEVLEHDTRQLIENvLvDYTGLtpsRcKQSKaLTTMKRVVk
  d           ---                   p                f g     sqp w    p        e
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:***********:.************.:******:**** ********************** *****:: ***:*:**
DiIAKHRYAYNGMiaKLDLDDRCDDMSfiNSVAKTlFSDGtTNWGRIASLVAFGAVVSQHLKEiGRGHCiesVGQkItTY
 v           vv            vv      m    i                      s     vdl   e a  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************:****.**:********                            
LLSDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLiAFAGfAGlGATLAMLI----------------------------
                                   l    v  i        sqppiqnqipvaqewitsipvvvfssps
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gckhthyritphlrgvsvndvgslsrhrlpclsrliglsclsriarlpclsrliglsclcqiarlpcfhrlvrisclsrs
                                                                                

       410       420       430       440       450       460        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                               *    
---------------------------------------------------------------R-s--
vrfprpsrldrfprlsrrdrfprfsrghqsapdpwvclpyrrpaagaarrgggsvtytlspts s-gd
                                                                n ac
© 1998-2023Legal notice