Dataset for protein Mcl-1 of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8CMB3_MCL1-02      MSLSKSITRATTTMLNFQNGVVGGSSYPA--GTSLYYFGETGAVRAGASP
A0A8C8CMB3_MCL1-01      MSLSKSITRATTTMLNFQNGVVGGSSYPA--GTSLYYFGETGAVRAGASP
A0A8C8LPV9_MCL1-01      MSLSKSIARATTTMLHFQN---GGSSYLADDASPLYYFD--GAVCAGASP
                        *******:*******:***   ***** *  .:.****.  *** *****

A0A8C8CMB3_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLP
A0A8C8CMB3_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLP
A0A8C8LPV9_MCL1-01      KSKV--DLGNGTGDT-PRPTTLGMNVVKTNVLDNHLSDRSNNDD---SLP
                        ****  ********* ****.**:****:***.***********   ***

A0A8C8CMB3_MCL1-02      CTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLTPSRCKQSK
A0A8C8CMB3_MCL1-01      CTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLTPSRCKQSK
A0A8C8LPV9_MCL1-01      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWKQSK
                        **************** ****************.* *****: .* ****

A0A8C8CMB3_MCL1-02      ALTTMKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDG
A0A8C8CMB3_MCL1-01      ALTTMKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDG
A0A8C8LPV9_MCL1-01      PLTTMKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVVNSVAKTMFSDG
                        .********:*:***********:.************.:******:****

A0A8C8CMB3_MCL1-02      TTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLLSDQRDWLV
A0A8C8CMB3_MCL1-01      TTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLLSDQRDWLV
A0A8C8LPV9_MCL1-01      ITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGQEIATYLLSDQRDWLV
                         ********************** *****:: ***:*:************

A0A8C8CMB3_MCL1-02      KNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLISQPPIQNQ
A0A8C8CMB3_MCL1-01      KNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLI--------
A0A8C8LPV9_MCL1-01      KNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLI--------
                        *************************:****.**:********        

A0A8C8CMB3_MCL1-02      IPVAQEWITSIPVVVFSSPSGCKHTHYRITPHLRGVSVNDVGSLSRHRLP
A0A8C8CMB3_MCL1-01      --------------------------------------------------
A0A8C8LPV9_MCL1-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      CLSRLIGLSCLSRIARLPCLSRLIGLSCLCQIARLPCFHRLVRISCLSRS
A0A8C8CMB3_MCL1-01      --------------------------------------------------
A0A8C8LPV9_MCL1-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      VRFPRPSRLDRFPRLSRRDRFPRFSRGHQSAPDPWVCLPYRRPAAGAARR
A0A8C8CMB3_MCL1-01      --------------------------------------------------
A0A8C8LPV9_MCL1-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      GGGSVTYTLSPTSRSSGC
A0A8C8CMB3_MCL1-01      -------------RNSAD
A0A8C8LPV9_MCL1-01      -------------R----
                                     *    

© 1998-2023Legal notice