Dataset for protein Mcl-1 of organism Oncorhynchus tshawytscha

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C8CMB3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=MCL-1 (length=466 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLTPSRCKQSKALTTMKRVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLISQPPIQNQIPVAQEWITSIPVVVFSSPSGC
KHTHYRITPHLRGVSVNDVGSLSRHRLPCLSRLIGLSCLSRIARLPCLSRLIGLSCLCQIARLPCFHRLVRISCLSRSVR
FPRPSRLDRFPRLSRRDRFPRFSRGHQSAPDPWVCLPYRRPAAGAARRGGGSVTYTLSPTSRSSGC
>gnl|bcl2dbpro|A0A8C8CMB3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=MCL-1 (length=295 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLTPSRCKQSKALTTMKRVVKDI
IAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLL
SDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A8C8LPV9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus tshawytscha GN=MCL-1 (length=282 residues).
MSLSKSIARATTTMLHFQNGGSSYLADDASPLYYFDGAVCAGASPKSKVDLGNGTGDTPRPTTLGMNVVKTNVLDNHLSD
RSNNDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWKQSKPLTTMKRVVEDVIAKHRYAYN
GMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGQEIATYLLSDQRDWLVK
NNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIR
© 1998-2023Legal notice