Dataset for protein BCL-2-like of organism Oncorhynchus kisutch

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .        :                                                                 
-mmlysn----relvvyfinyklsqrsypadqlgleeasgrtegggaipkskv----gng-----n-g-pgs-pprpt-l
m-assdsitratttmlkyqt---ggsn-lwnhpvptgye-gavnaqvsgngsldtdlttrrngrs-l-stsdtaqlq-t-
 sstdnlpanvpfilehlkshvvlkkgfafcfisclfg-tapnrdemeagapgsssvlaypchtvvgtmsttvyhg-spp
 ilnpkigy skc  kf  cgr a  d -cgdelayy-pssd cesrwsppat pe mynwssgaanavdans - snrv
   cn   n   a   n  v      i v--tatendtid   h yg  sren    f hskqpg e r   p s  kki
   ai              h        s e yp   eqr     f   dl      a     f    k   m     w 
                                sn   d n                            g           
                                me                                  e           
                                 d                                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
svp-----------------------------------------------------------------------------
g-nkcfmcnleiknfvvksnvlgnhifhvyntsgrckylsdrsnnddsdgslpctpqryrrgkiafpdsimasecgpels
-s-             endtl de               t  yt redemm llgke             itnst a   
pqt                                                                             
dth                                                                             
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        :     :.   :   :  :   * .        .   *  
------------------------------ragqskvktalrdsvdefelryrrafsdmssqLhltprtaymsf-esVmd
ncqsgdevlehdtrqlienvlveytglsqp--klhaal-tmkrvgndliakhtydynglivk diddacddrrvvnn ak
         dt      ddm rdc   ldrtwaiery-e- seaakqilrl qpt ae vht yv ssm eqk ire ih
                 kc  gq     r hmrmdp  a     ie v im a      ca   f   g qh  lta  e
                            k  cne    s      g   e          n         nv   s    
                                                            g                   
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :* **  ****: .:  **..:.           :  :   :: **      *: .:. *: *.*::            
evFrDGv-NWGRvvglfaFGgalcvecvekemshlvdriadwmttYLdnhiqpWiqsnggWdrFvEifg-qdaaasvrns
tl s  tt    iasfve  avvsqhlknsgrgpciglvgreiae  lsdqrd lvkqna ng a fyhv--pes--qrt
sm e  iv     ia ts   ti rysrgid tsq ts tqk sv  ngplln   eh s ea   d re---esmqr
 i                    m     dr  nn  eh  v      vt hk       d  h     p k    dk ky
                                d   an  h          h                  m    rc di
                                        g                             a         
                                        e                                       
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :         :                                                                  
qesfkkwlllgatl------vagv-vg-li-qk-----------------------------------------------
lsalagfagikvvfgmlirglt-lt--t--m--rqfvcypvyprtnyihsfqmdtlhniedskilflfsvlqevkpnlfs
iivissvpsvdtmmalaalqass-li syvak cl                                             
drt iel--a mi vgmvtn--a pq avltl                                                
amn h ify  s  tf smkcpd i  c fc                                                 
 lk g               s   v     i                                                 
    f                                                                           
    c                                                                           
                                                                                

       410    
....:....|....
              
--------------
fdiffkcsvpsllc
              
              
              
              
              
              
              
© 1998-2022Legal notice