Dataset for protein BCL-2-like of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7CHJ0_BCL2-01      -MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPEND---SPNNGFGEPS
A0A8C7G8X1_BCL2-01      -MANDDN----RFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISP
A0A8C7N3I9_BCL2-01      -MANDDN----RCIVEKYICHKLLKRGYAWDFENAEED--ADNNGSMISP
A0A8C7IJ10_BCL2L1-      --MCINL----PELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGG
A0A8C7J9N8_BCL2L1-      -MMTYNN----RELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGG
A0A8C7IJ10_BCL2L1-      -IMTYNN----RELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGG
A0A8C7CBC7_BCL2L1-      --MSYSN----RELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIAN
A0A8C7CBC7_BCL2L1-      --MSYSN----RELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIAN
A0A8C7FX38_BCL2L1-      --MSYSN----RELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIAN
A0A8C7N2B4_MCL1-01      -MACPDIGNRVKATLKHLKV---AGSI----DSTPLFTSRGPEHEYRWGD
A0A8C7H400_MCL1-01      -MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPK
A0A8C7H400_MCL1-02      -MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPK
A0A8C7H1W6_MCL1-01      MSLLSSSIARATTTMLHFQN---GGSSYLADDASPLYYIDGAVCAGASPK
A0A8C7H1W6_MCL1-02      MSLLSSSIARATTTMLHFQN---GGSSYLADDASPLYYIDGAVCAGASPK
                             .        :                                   

A0A8C7CHJ0_BCL2-01      PPNSPEVFARRSQPSAEGVDTDSP-LQNRIPQP-----------------
A0A8C7G8X1_BCL2-01      RPG----LARRCHGANNGGPGSVPSLSKWLSQP-----------------
A0A8C7N3I9_BCL2-01      PPG----LARRCHGANNARPGSVPHLSKRLSQT-----------------
A0A8C7IJ10_BCL2L1-      AAV----TTHPNGTVNGTSPGT-PPRQSPPSSP-----------------
A0A8C7J9N8_BCL2L1-      AAV----MTY----VNGTSPGTPPPRQSPPSSP-----------------
A0A8C7IJ10_BCL2L1-      AAV----TTHPNGTVNGTSPGT-PPRQSPPSSP-----------------
A0A8C7CBC7_BCL2L1-      GSL----GNNRNGRSNLGMPSS-AQG------------------------
A0A8C7CBC7_BCL2L1-      GSL----GNNRNGRSNLGMPSS-AQG------------------------
A0A8C7FX38_BCL2L1-      GSV----GNYWNSRSNLAKPSS-PQG------------------------
A0A8C7N2B4_MCL1-01      LETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMCNLEIKNFVENDT
A0A8C7H400_MCL1-01      SKVDTDLGNG---------TGDTPPRPTKLGVN------------VVKSN
A0A8C7H400_MCL1-02      SKVDTDLGNG---------TGDTPPRPTKLGVN------------VVKSN
A0A8C7H1W6_MCL1-01      SKV--DLGNG---------TGDTPPRPTTLGVN------------VVKSN
A0A8C7H1W6_MCL1-02      SKV--DLGNG---------TGDTPPRPTTLGVN------------VVKSN
                                                                          

A0A8C7CHJ0_BCL2-01      --------------------------------------------------
A0A8C7G8X1_BCL2-01      --------------------------------------------------
A0A8C7N3I9_BCL2-01      --------------------------------------------------
A0A8C7IJ10_BCL2L1-      --------------------------------------------------
A0A8C7J9N8_BCL2L1-      --------------------------------------------------
A0A8C7IJ10_BCL2L1-      --------------------------------------------------
A0A8C7CBC7_BCL2L1-      --------------------------------------------------
A0A8C7CBC7_BCL2L1-      --------------------------------------------------
A0A8C7FX38_BCL2L1-      --------------------------------------------------
A0A8C7N2B4_MCL1-01      LLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSI
A0A8C7H400_MCL1-01      VLGNH-------------LSDRSNNDDSDGSLPCTPQ-------------
A0A8C7H400_MCL1-02      VLGNH-------------LSDRSNNDDSDGSLPCTPQ-------------
A0A8C7H1W6_MCL1-01      VLDNH-------------LSDRSNNDD---SLPCTPQ-------------
A0A8C7H1W6_MCL1-02      VLDNH-------------LSDRSNNDD---SLPCTPQ-------------
                                                                          

A0A8C7CHJ0_BCL2-01      --------------------------------------DRHARLHRV---
A0A8C7G8X1_BCL2-01      --------------------------------------DPHAAIHRV---
A0A8C7N3I9_BCL2-01      --------------------------------------DPHAAIHRV---
A0A8C7IJ10_BCL2L1-      --------------------------------------QRTMGLDAVKEA
A0A8C7J9N8_BCL2L1-      --------------------------------------RRTAGLDAVKEA
A0A8C7IJ10_BCL2L1-      --------------------------------------QRTMGLDAVKEA
A0A8C7CBC7_BCL2L1-      ------------------------------------------GIEAVKAA
A0A8C7CBC7_BCL2L1-      ------------------------------------------GIEAVKAA
A0A8C7FX38_BCL2L1-      ------------------------------------------GMEPVKAA
A0A8C7N2B4_MCL1-01      ITNSTGA-----------LDTDTRQLIKCVLGQCTGLLKPRWNESKALST
A0A8C7H400_MCL1-01      MASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLS--RCKQSKALTT
A0A8C7H400_MCL1-02      MASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLS--RCKQSKALTT
A0A8C7H1W6_MCL1-01      MASECGPEL---------LEHDTRQLIDDMLREYTGLSQPRWKQSKYLTT
A0A8C7H1W6_MCL1-02      MASECGPEL---------LEHDTRQLIDDMLREYTGLSQPRWKQSKYLTT
                                                                          

A0A8C7CHJ0_BCL2-01      LREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRF-TAVIEELFSDGV-NW
A0A8C7G8X1_BCL2-01      LREAGDELERLYQPDFAEMSHQLYLTSSTAERRF-REVIDELFRDGV-NW
A0A8C7N3I9_BCL2-01      LREAGDELERLYQPDFAEMSHQLYLTSSMAERRF-REVIDELFRDGV-NW
A0A8C7IJ10_BCL2L1-      LRDSANEFELRYARAFSDLSSQLHITPATAYQSF-ENVMDEVFRDGV-NW
A0A8C7J9N8_BCL2L1-      LRDSANEFELRYARAFSDLSSQLHITPSTAYQSF-ENVMDEVFRDGV-NW
A0A8C7IJ10_BCL2L1-      LRDSANEFELRYARAFSDLSSQLHITPATAYQSF-ENVMDEVFRDGV-NW
A0A8C7CBC7_BCL2L1-      LRDSVDEFELRYTRAFSDLCSQLHITPATAYHSF-ESVMDEVFRDGV-NW
A0A8C7CBC7_BCL2L1-      LRDSVDEFELRYTRAFSDLCSQLHITPATAYHSF-ESVMDEVFRDGV-NW
A0A8C7FX38_BCL2L1-      LRDSVDEFELRYTRAFSDLSSQLHITPATAYHSF-ESVMDEVFRDGV-NW
A0A8C7N2B4_MCL1-01      MSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNW
A0A8C7H400_MCL1-01      MKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNW
A0A8C7H400_MCL1-02      MKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNW
A0A8C7H1W6_MCL1-01      MKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNW
A0A8C7H1W6_MCL1-02      MKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVVNSVAKTMFSDGITNW
                        :     :.   :   :  :   * .        .   *   :* **  **

A0A8C7CHJ0_BCL2-01      GRIVAFFEFGGTMCVESVNREMTSQVDNIAHWMTEYLNGPLQNWIQENGD
A0A8C7G8X1_BCL2-01      GRIIAFFEFGGTICVECVNKEMTSQVDHIAVWMTEYLNGPLLNWIQENGG
A0A8C7N3I9_BCL2-01      GRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHNWIQENGG
A0A8C7IJ10_BCL2L1-      GRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGG
A0A8C7J9N8_BCL2L1-      GRVVGLFAFGGALCVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGG
A0A8C7IJ10_BCL2L1-      GRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGG
A0A8C7CBC7_BCL2L1-      GRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGG
A0A8C7CBC7_BCL2L1-      GRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGG
A0A8C7FX38_BCL2L1-      GRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGG
A0A8C7N2B4_MCL1-01      GRVASLTSFGAAVCRYLRGKGRDNCVDLVGEEISEYLVTHHKDWLVKHNS
A0A8C7H400_MCL1-01      GRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSDQRDWLVKNNA
A0A8C7H400_MCL1-02      GRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSDQRDWLVKNNA
A0A8C7H1W6_MCL1-01      GRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNA
A0A8C7H1W6_MCL1-02      GRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNA
                        **: .:  **..:.           :  :   :: **      *: .:. 

A0A8C7CHJ0_BCL2-01      WDAFVEIYG--------QQRISAFHSWPYLKTVFGLAALGAAGVTIGALF
A0A8C7G8X1_BCL2-01      WEAFVELYD--------RQRDSVFCSWPSIKTVFGLAALGAASLTIGAYL
A0A8C7N3I9_BCL2-01      WEAFVELYD--------RQRDSVFGSWPSIKTVFGLAALGAASLTIGAYL
A0A8C7IJ10_BCL2L1-      WDRFAEIFG-KDAAAESRKSQESFKKWLLAGMTL------VTGVIVGSLI
A0A8C7J9N8_BCL2L1-      WDRFAEIFG-MDAAAESRKSQESFKKWFLAGMTL------VTGVVVGSLF
A0A8C7IJ10_BCL2L1-      WDRFAEIFG-KDAAAESRKSQESFKKWLLAGMTL------VTGVIVGSLI
A0A8C7CBC7_BCL2L1-      WDRFAEIFG-RDAAADVRRSQESLKKWLLVGVML------LSGVLVGTLI
A0A8C7CBC7_BCL2L1-      WDRFAEIFG-RDAAADVRRSQESLKKWLLVGVML------LSGVLVGTLI
A0A8C7FX38_BCL2L1-      WDHFAEIFG-RDAAADVRRSQENIIKWLLVGVIL------LSGVLVGTLI
A0A8C7N2B4_MCL1-01      WNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM-----------
A0A8C7H400_MCL1-01      WNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRQCPALPQGCVV
A0A8C7H400_MCL1-02      WNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRNSAD-------
A0A8C7H1W6_MCL1-01      WNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIRKCPALPQGCVV
A0A8C7H1W6_MCL1-02      WNGFVEFFHVQDPESSKMDYARKFSEI--LDSTMVGMSTQ----------
                        *: *.*::               :         :                

A0A8C7CHJ0_BCL2-01      IQK-----------------------------------------------
A0A8C7G8X1_BCL2-01      TQK-----------------------------------------------
A0A8C7N3I9_BCL2-01      TQK-----------------------------------------------
A0A8C7IJ10_BCL2L1-      AQKRL---------------------------------------------
A0A8C7J9N8_BCL2L1-      AQKRL---------------------------------------------
A0A8C7IJ10_BCL2L1-      AQKRL---------------------------------------------
A0A8C7CBC7_BCL2L1-      MKKCQFVCYPVYPRTNYIHSFQMDTLHNIEDSKILFLFSVLQEVKPNLFS
A0A8C7CBC7_BCL2L1-      MKKCQ---------------------------------------------
A0A8C7FX38_BCL2L1-      MKKRQ---------------------------------------------
A0A8C7N2B4_MCL1-01      --------------------------------------------------
A0A8C7H400_MCL1-01      CL------------------------------------------------
A0A8C7H400_MCL1-02      --------------------------------------------------
A0A8C7H1W6_MCL1-01      CL------------------------------------------------
A0A8C7H1W6_MCL1-02      --------------------------------------------------
                                                                          

A0A8C7CHJ0_BCL2-01      --------------
A0A8C7G8X1_BCL2-01      --------------
A0A8C7N3I9_BCL2-01      --------------
A0A8C7IJ10_BCL2L1-      --------------
A0A8C7J9N8_BCL2L1-      --------------
A0A8C7IJ10_BCL2L1-      --------------
A0A8C7CBC7_BCL2L1-      FDIFFKCSVPSLLC
A0A8C7CBC7_BCL2L1-      --------------
A0A8C7FX38_BCL2L1-      --------------
A0A8C7N2B4_MCL1-01      --------------
A0A8C7H400_MCL1-01      --------------
A0A8C7H400_MCL1-02      --------------
A0A8C7H1W6_MCL1-01      --------------
A0A8C7H1W6_MCL1-02      --------------
                                      

© 1998-2022Legal notice