Dataset for protein BCL-2-like of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A8C7CBC7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=278 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQFVCYPVYPRTNYIHSFQMDTL
HNIEDSKILFLFSVLQEVKPNLFSFDIFFKCSVPSLLC
>gnl|bcl2dbpro|A0A8C7CBC7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A8C7CHJ0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFYPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTDSPLQNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISAFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A8C7FX38_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNYWNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDHFAEIFGRDAAADVRRSQENIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A8C7G8X1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRPGLARRCHGANNGGPGSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A8C7H1W6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=288 residues).
MSLLSSSIARATTTMLHFQNGGSSYLADDASPLYYIDGAVCAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNVLDNHL
SDRSNNDDSLPCTPQMASECGPELLEHDTRQLIDDMLREYTGLSQPRWKQSKYLTTMKRVVEDVIAKHRYAYNGMVVKLD
LDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNAWNGF
VEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIRKCPALPQGCVVCL
>gnl|bcl2dbpro|A0A8C7H1W6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=274 residues).
MSLLSSSIARATTTMLHFQNGGSSYLADDASPLYYIDGAVCAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNVLDNHL
SDRSNNDDSLPCTPQMASECGPELLEHDTRQLIDDMLREYTGLSQPRWKQSKYLTTMKRVVEDVIAKHRYAYNGMVVKLD
LDDRCDDMSVVNSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGREIATYLLSDQRDWLVKNNAWNGF
VEFFHVQDPESSKMDYARKFSEILDSTMVGMSTQ
>gnl|bcl2dbpro|A0A8C7H400_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=302 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSRCKQSKALTTMKRVVKDIIA
KHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSD
QRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRQCPALPQGCVVCL
>gnl|bcl2dbpro|A0A8C7H400_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=293 residues).
MSLSKSITRATTTMLNFQNGVVGGSSYPAGTPLCYFGETGAVRAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVL
GNHLSDRSNNDDSDGSLPCTPQMASECGPELSNCQSGDEVLEHDTRQLIENVLVDYTGLSRCKQSKALTTMKRVVKDIIA
KHRYAYNGMIAKLDLDDRCDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKIATYLLSD
QRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGFAGLGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A8C7IJ10_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=231 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMGLD
AVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVG
RIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C7IJ10_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=230 residues).
MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMGLDA
VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C7J9N8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVMTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWFLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A8C7N2B4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=MCL-1 (length=320 residues).
MACPDIGNRVKATLKHLKVAGSIDSTPLFTSRGPEHEYRWGDLETDSSLAYGSKHFGVLGESANMYHLPNTVDTHKCFMC
NLEIKNFVENDTLLGEHIFHVYNTSGRCKYLTDRYTNREDEMMLLLGKERYRRGKIAFPDSIITNSTGALDTDTRQLIKC
VLGQCTGLLKPRWNESKALSTMSRVIGQLLEKHRYTYNGMINTLYVDDRGDNVKFLSAVAHSIFEDGTVNWGRVASLTSF
GAAVCRYLRGKGRDNCVDLVGEEISEYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRCRNIIMTIFGLAGIGATMTFLVM
>gnl|bcl2dbpro|A0A8C7N3I9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL-2 (length=224 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEEDADNNGSMISPPPGLARRCHGANNARPGSVPHLSKRLSQTDPHAAIHR
VLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAG
WMTEYLNGPLHNWIQENGGWEAFVELYDRQRDSVFGSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2022Legal notice