Dataset for protein Bcl-xL of organism Oncorhynchus kisutch

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *  .  ****::*:*.****:*.  :: *  * .****.:. ...:: .      *   *.: .             *:
-MsysnrELVVyyItYkLSQRnYpfnqlgLtgAsgRTEGgqvigngsvgtyrngrvNltsPst-pqr-----------Gl
m tinlp    ff s r    d scchiv ee ps    deaeagaaltnnp--ts ggm gspapgqsppsspqrtm i
i                        me    qn             m h- s-   ak              r  a m
                                                   w                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.** *****.:******:******.*******:***:***.******************************:*:*. **
eaVKeALRDSvnEFELRYtRAFSDLsSQLHITPaTAYqSFEsVMDEVFRDGVNWGRVVGLFAFGGALCVECVeKeMspLV
dp  a     ad      a      c       s   h   n                              d d nh  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 **:***:.*****************.****** ****: *.***.: **:*.*: *::**:**:*: :*          
gRIaDWMtvYLDNHIQPWIQSQGGWDrFAEIFGrDAAAevRrSQEsfkKWlLvGvtLvtGVlVGtLimqKrq--------
t  t   at                 h      k    ds k   nli  f a mm ls  i  s fak clfvcypvyp
a                                m            i        i     v                  
                                                                                

       250       260       270       280       290 
....:....|....:....|....:....|....:....|....:....|.
                                                   
---------------------------------------------------
rtnyihsfqmdtlhniedskilflfsvlqevkpnlfsfdiffkcsvpsllc
                                                   
                                                   
© 1998-2022Legal notice