Dataset for protein Bcl-xL of organism Oncorhynchus kisutch

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7IJ10_BCL2L1-      -MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTT
A0A8C7J9N8_BCL2L1-      MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVMT
A0A8C7IJ10_BCL2L1-      IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTT
A0A8C7CBC7_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGN
A0A8C7CBC7_BCL2L1-      -MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGN
A0A8C7FX38_BCL2L1-      -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGN
                         *  .  ****::*:*.****:*.  :: *  * .****.:. ...:: .

A0A8C7IJ10_BCL2L1-      HPNGTVNGTSPGT-PPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYAR
A0A8C7J9N8_BCL2L1-      Y----VNGTSPGTPPPRQSPPSSPRRTAGLDAVKEALRDSANEFELRYAR
A0A8C7IJ10_BCL2L1-      HPNGTVNGTSPGT-PPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYAR
A0A8C7CBC7_BCL2L1-      NRNGRSNLGMPSS-AQG-----------GIEAVKAALRDSVDEFELRYTR
A0A8C7CBC7_BCL2L1-      NRNGRSNLGMPSS-AQG-----------GIEAVKAALRDSVDEFELRYTR
A0A8C7FX38_BCL2L1-      YWNSRSNLAKPSS-PQG-----------GMEPVKAALRDSVDEFELRYTR
                              *   *.: .             *::.** *****.:******:*

A0A8C7IJ10_BCL2L1-      AFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVE
A0A8C7J9N8_BCL2L1-      AFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVE
A0A8C7IJ10_BCL2L1-      AFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVE
A0A8C7CBC7_BCL2L1-      AFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVE
A0A8C7CBC7_BCL2L1-      AFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVE
A0A8C7FX38_BCL2L1-      AFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVE
                        *****.*******:***:***.****************************

A0A8C7IJ10_BCL2L1-      CVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAES
A0A8C7J9N8_BCL2L1-      CVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAES
A0A8C7IJ10_BCL2L1-      CVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAES
A0A8C7CBC7_BCL2L1-      CVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDRFAEIFGRDAAADV
A0A8C7CBC7_BCL2L1-      CVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDRFAEIFGRDAAADV
A0A8C7FX38_BCL2L1-      CVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDHFAEIFGRDAAADV
                        **:*:*. ** **:***:.*****************.****** ****: 

A0A8C7IJ10_BCL2L1-      RKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL------------------
A0A8C7J9N8_BCL2L1-      RKSQESFKKWFLAGMTLVTGVVVGSLFAQKRL------------------
A0A8C7IJ10_BCL2L1-      RKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL------------------
A0A8C7CBC7_BCL2L1-      RRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQFVCYPVYPRTNYIHSFQM
A0A8C7CBC7_BCL2L1-      RRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ------------------
A0A8C7FX38_BCL2L1-      RRSQENIIKWLLVGVILLSGVLVGTLIMKKRQ------------------
                        *.***.: **:*.*: *::**:**:*: :*                    

A0A8C7IJ10_BCL2L1-      -----------------------------------------
A0A8C7J9N8_BCL2L1-      -----------------------------------------
A0A8C7IJ10_BCL2L1-      -----------------------------------------
A0A8C7CBC7_BCL2L1-      DTLHNIEDSKILFLFSVLQEVKPNLFSFDIFFKCSVPSLLC
A0A8C7CBC7_BCL2L1-      -----------------------------------------
A0A8C7FX38_BCL2L1-      -----------------------------------------
                                                                 

© 1998-2022Legal notice