Dataset for protein Bcl-xL of organism Oncorhynchus kisutch

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C7CBC7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=278 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQFVCYPVYPRTNYIHSFQMDTL
HNIEDSKILFLFSVLQEVKPNLFSFDIFFKCSVPSLLC
>gnl|bcl2dbpro|A0A8C7CBC7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGMPSSAQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLKKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A8C7FX38_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNYWNSRSNLAKPSSPQGGMEPVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDHFAEIFGRDAAADVRRSQENIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A8C7IJ10_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=231 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMGLD
AVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVG
RIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C7IJ10_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=230 residues).
MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMGLDA
VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C7J9N8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oncorhynchus kisutch GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVMTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWFLAGMTLVTGVVVGSLFAQKRL
© 1998-2022Legal notice