Dataset for protein Bcl2l10 of organism Nothobranchius furzeri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 *   * ::. :  ******************
------------------------------------------------pW---RgvsstsysKMSCGLWNDTLAVAEDYL
mggglnaqkgsgdcpevllppsgcgeschlplggehgtsdrasmstsgm vpt elaplagr                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
STCCCGPNPAPPPPSETAAAMRRLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNWGRVVSLFAFT
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLVKHKKGWLLENEGWEGFSQYSHNTRPVSLDSSMKTALVA
                                                                                

       250     
....:....|....:
***************
VAGVGLAGLTFLLVR
               
© 1998-2021Legal notice