Dataset for protein Bcl2l10 of organism Nothobranchius furzeri

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1A8VCB0_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L10 (length=204 residues).
MWRELSPTAGRKMSCGLWNDTLAVAEDYLSTCCCGPNPAPPPPSETAAAMRRLAQDMETQHQTRFHSLAQNFLKRCGPDI
CSSLRKVMDEMAGDGHFNWGRVVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLVKHKKGWLLE
NEGWEGFSQYSHNTRPVSLDSSMKTALVAVAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A1A8VCB0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nothobranchius furzeri GN=BCL2L10 (length=255 residues).
MGGGLNAQKGSGDCPEVLLPPSGCGESCHLPLGGEHGTSDRASMSTSGPWVPTRGVASLSYSKMSCGLWNDTLAVAEDYL
STCCCGPNPAPPPPSETAAAMRRLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNWGRVVSLFAFT
GVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADYLVKHKKGWLLENEGWEGFSQYSHNTRPVSLDSSMKTALVA
VAGVGLAGLTFLLVR
© 1998-2021Legal notice