Dataset for protein Bcl2l10 of organism Nothobranchius furzeri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1A8VCB0_BCL2L10      ------------------------------------------------MW
A0A1A8VCB0_BCL2L10      MGGGLNAQKGSGDCPEVLLPPSGCGESCHLPLGGEHGTSDRASMSTSGPW
                                                                         *

A0A1A8VCB0_BCL2L10      ---RELSPTAGRKMSCGLWNDTLAVAEDYLSTCCCGPNPAPPPPSETAAA
A0A1A8VCB0_BCL2L10      VPTRGVASLSYSKMSCGLWNDTLAVAEDYLSTCCCGPNPAPPPPSETAAA
                           * ::. :  **************************************

A0A1A8VCB0_BCL2L10      MRRLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNW
A0A1A8VCB0_BCL2L10      MRRLAQDMETQHQTRFHSLAQNFLKRCGPDICSSLRKVMDEMAGDGHFNW
                        **************************************************

A0A1A8VCB0_BCL2L10      GRVVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADY
A0A1A8VCB0_BCL2L10      GRVVSLFAFTGVLIRQLQEQRTSRPGLDPGQELEPKLISCRLLAETIADY
                        **************************************************

A0A1A8VCB0_BCL2L10      LVKHKKGWLLENEGWEGFSQYSHNTRPVSLDSSMKTALVAVAGVGLAGLT
A0A1A8VCB0_BCL2L10      LVKHKKGWLLENEGWEGFSQYSHNTRPVSLDSSMKTALVAVAGVGLAGLT
                        **************************************************

A0A1A8VCB0_BCL2L10      FLLVR
A0A1A8VCB0_BCL2L10      FLLVR
                        *****

© 1998-2021Legal notice