Dataset for protein Mcl-1 of organism Neogobius melanostomus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .  ::  :...**.:*.     : : ************************
mlpakrtkfgipttmlgmlmpqngvveaegamtmdarngngSLshChp----qqqrPTALQVKNDHSRKHKNLREGDYDH
------------------------------vcylqngqnsa  qq wvclclkmes                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************************** :  
NSDGGSLPCTPEFQSDSEQEMSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRlnlp
                                                                            ydkq

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ... **************************************************************************
snpnw-GDDVTFMGDVARSIFEDGTTNWGRIASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWD
tvsgrq                                                                          

       250       260       270       
....:....|....:....|....:....|....:..
*************************************
GFVEFFRVDDPESKVRNTLMAVAGLAGIGATLAMLIR
                                     
© 1998-2022Legal notice