Dataset for protein Mcl-1 of organism Neogobius melanostomus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=273 residues).
MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHPQQQRPTALQVKNDHSRKHKNLREGDYDHNSDG
GSLPCTPEFQSDSEQEMSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRYDKQTVSG
RQGDDVTFMGDVARSIFEDGTTNWGRIASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVE
FFRVDDPESKVRNTLMAVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=272 residues).
MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHPQQQRPTALQVKNDHSRKHKNLREGDYDHNSDG
GSLPCTPEFQSDSEQEMSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRLNLPSNPN
WGDDVTFMGDVARSIFEDGTTNWGRIASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEF
FRVDDPESKVRNTLMAVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A8C6SVR4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neogobius melanostomus GN=MCL-1 (length=246 residues).
VCYLQNGQNSASLQQCWVCLCLKMESPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQEMSGYSVENDT
RQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHRIAYNGRLNLPSNPNWGDDVTFMGDVARSIFEDGTTNWGRI
ASLISFGAVVCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEFFRVDDPESKVRNTLMAVAGLAGIGAT
LAMLIR
© 1998-2022Legal notice