Dataset for protein Mcl-1 of organism Neogobius melanostomus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6SVR4_MCL1-02      MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHP--
A0A8C6SVR4_MCL1-03      MLPAKRTKFGIPTTMLGMLMPQNGVVEAEGAMTMDARNGNGSLSHCHP--
A0A8C6SVR4_MCL1-01      ------------------------------VCYLQNGQNSASLQQCWVCL
                                                      .  ::  :...**.:*.   

A0A8C6SVR4_MCL1-02      --QQQRPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
A0A8C6SVR4_MCL1-03      --QQQRPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
A0A8C6SVR4_MCL1-01      CLKMESPTALQVKNDHSRKHKNLREGDYDHNSDGGSLPCTPEFQSDSEQE
                          : : ********************************************

A0A8C6SVR4_MCL1-02      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHR
A0A8C6SVR4_MCL1-03      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHR
A0A8C6SVR4_MCL1-01      MSGYSVENDTRQLLGDFFELITGISQPGWLQRPALTTMKRVVDNLLEKHR
                        **************************************************

A0A8C6SVR4_MCL1-02      IAYNGRYDKQTVSGRQGDDVTFMGDVARSIFEDGTTNWGRIASLISFGAV
A0A8C6SVR4_MCL1-03      IAYNGRLNLPSNPNW-GDDVTFMGDVARSIFEDGTTNWGRIASLISFGAV
A0A8C6SVR4_MCL1-01      IAYNGRLNLPSNPNW-GDDVTFMGDVARSIFEDGTTNWGRIASLISFGAV
                        ****** :  : ... **********************************

A0A8C6SVR4_MCL1-02      VCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEFFRVDD
A0A8C6SVR4_MCL1-03      VCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEFFRVDD
A0A8C6SVR4_MCL1-01      VCQYLKSKGRESCVERVAEEISSYLLSDQRDWLIRNNSWDGFVEFFRVDD
                        **************************************************

A0A8C6SVR4_MCL1-02      PESKVRNTLMAVAGLAGIGATLAMLIR
A0A8C6SVR4_MCL1-03      PESKVRNTLMAVAGLAGIGATLAMLIR
A0A8C6SVR4_MCL1-01      PESKVRNTLMAVAGLAGIGATLAMLIR
                        ***************************

© 1998-2022Legal notice