Dataset for protein BCL-2-like of organism Nannospalax galili

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    :           
---------------------------------------------------------------pdtrelv----------
mfglrrnaviglnlycggaslaagmatpasaglvaeeakarcegggeagagsggsvsmtdplrysnysiarpppigaevp
                        gshagrts                         gpacel--- avl          
                          s  gmr                          a a ftrv r            
                                                               q a q            
                                                               e                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   .   :                                        
----------------------------------edylgyk----------lsqrgyewg-----ag-------------
dvtatpeklmlfpagrasppedmaapaaaimspemkfvqfvpeplgkrpavarvpsfvsdqfsdv--padaaplgatsap
                                  aelih e           qlkltsca     eedstgtdgstpptr
                                  v  ds c           pe  lrgs      anrse  e le e 
                                  i   l                   el       k            
                                                           e                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .           :  :              
------------------------------------pspasrvlh-tlrsagdeferryrryfsdmssqlhvtpgtarqr
gifsslpgsnptaavhqspaartspprlpaamagqglg-vpppv-qamfqvqkdvstnlkptldnldv---lstfslqts
ptveeinelyrswllvidryvngqtthassslplrae-s-ad-aqlvv a aaqtqqlhqtd aefaak diqndddygi
epp add    qshaid   l eaagg kd kdageapkt--r-lkia r   g ll fela qs tr   ypin  vll
                                     iasveak e   e      k    f  g rg    kge  sk 
                                       mga                        l          e  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .          ****:*.:. *.. .       : .              :             *:  . .*     
fvqvveelfrdg-vNWGRiVaffaFggvlcvesvnkeme-----plvdqvaywmttylnrhlg---dWiqsnggWd-gfv
sttamvkesqgqip    l tlvv aaamlkqlpqrqtsgrldvdtyknislfvadfietrthrhrt lrqskd -de-i
lnr sdvv eq vi    v viis   mvaak ksenqd  nrlvvlgrlqdsivevcvnnka   e  hdqd  ey-a-
 sm dnh  s  st         e   ff dh  di  q     scispclsm dll tdt r   p  vk    vlt t
 q       d   l                    c   k     h  rd  e      m l e   a  ee    a a c
 e                                                 c      k           a         
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rlfgpkslel---------------------------------------rlelmgqv-vga--t----------------
ekyer-agwetrklwesqnevekqmnmspppgnwrsvimsieekmeadaft-vllamw---vv-eleahfhgcgsvnrvt
-f---s----fersrlrl              gigp             -rwf---itlsgtla                
k-rvvqvrpsadfgq lf               aan             w-v-vtv-gyaclil                
aa rnpmpl s   k                                  nsryt nlf   hfe                
   hdnfea                                        l l s gad   ga                 
     gda                                         k i a   a   f                  
     e                                             a         c                  

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfys
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510 
....:....|....:....|....:....|.
                               
-----------------gswfllk-------
gfnsrprgrvyrgrarlellyswyrlwypgr
                v-aivgvrihh    
                it--lasihf     
                e vy  r        
                a if  p        
                      i        
                      h        
© 1998-2022Legal notice