Dataset for protein BCL-2-like of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6WBP6_BCL2L10      --------------------------------------------------
A0A8C6QF32_BCL2A1-      --------------------------------------------------
A0A8C6R201_BCL2A1-      --------------------------------------------------
A0A8C6W748_BCL2L1-      ------------------------------MS------------------
A0A8C6RID6_BCL2-02      ------------------------MAHAGRTG------------------
A0A8C6RID6_BCL2-01      ------------------------MAHAGRTG------------------
A0A8C6QA84_MCL1-01      MFGLRRNAVIGLNLYCGGASLAAGGSSPAGARLVAEEAKARCEGGGEAGA
A0A8C6RJE0_BCL2L2-      ------------------------MATPASA-------------------
A0A8C6RJE0_BCL2L2-      ------------------------MATPASA-------------------
                                                                          

A0A8C6WBP6_BCL2L10      -------MADPLRERTRQLL------------------------------
A0A8C6QF32_BCL2A1-      -------MTDCEFTSVYSLA------------------------------
A0A8C6R201_BCL2A1-      ----------------YSLA------------------------------
A0A8C6W748_BCL2L1-      -------------QSNRELV------------------------------
A0A8C6RID6_BCL2-02      -------------YDNREIV------------------------------
A0A8C6RID6_BCL2-01      -------------YDNREIV------------------------------
A0A8C6QA84_MCL1-01      GSGGSVSGPAALLPDARRVARPPPIGAEVPDVTATPEKLMLFPAGRASPP
A0A8C6RJE0_BCL2L2-      -------------PDTRALV------------------------------
A0A8C6RJE0_BCL2L2-      -------------PDTRALV------------------------------
                                          :                               

A0A8C6WBP6_BCL2L10      --------------IDYLLFC----------AREPGTREL----------
A0A8C6QF32_BCL2A1-      --------------EDYLQYV----------LQVPLFESA----------
A0A8C6R201_BCL2A1-      --------------EDYLQYV----------LQVPSFESA----------
A0A8C6W748_BCL2L1-      --------------VDFLSYK----------LSQKGYSWSQFSDVEENRT
A0A8C6RID6_BCL2-02      --------------MKYIHYK----------LSQRGYEWD-----AGDAD
A0A8C6RID6_BCL2-01      --------------MKYIHYK----------LSQRGYEWD-----AGDAD
A0A8C6QA84_MCL1-01      EDMAAPAAAIMSPEEELDGYEPEPLGKRPAVLPLRGLVGE-----AAKSS
A0A8C6RJE0_BCL2L2-      --------------ADFVGYK----------LRQKGYVCG-----AGP--
A0A8C6RJE0_BCL2L2-      --------------ADFVGYK----------LRQKGYVCG-----AGP--
                                       .   :                              

A0A8C6WBP6_BCL2L10      ----------------------------------------------PPSS
A0A8C6QF32_BCL2A1-      ----------------------------------------------PSKT
A0A8C6R201_BCL2A1-      ----------------------------------------------P---
A0A8C6W748_BCL2L1-      EAPEGTESERETPSAING-NPSWHLVDSPAVNGATGH-SSSLDARELIPM
A0A8C6RID6_BCL2-02      AAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAGQALSPV
A0A8C6RID6_BCL2-01      AAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAGQALSPV
A0A8C6QA84_MCL1-01      GTDGSLPSTPPPVEEDDELYRQSLAIISRYLREQATGAKDAKPLGGAGAA
A0A8C6RJE0_BCL2L2-      ---------------------------------------------GEGPA
A0A8C6RJE0_BCL2L2-      ---------------------------------------------GEGPA
                                                                          

A0A8C6WBP6_BCL2L10      SEAA--VLRSVAAQTLQLHQPFFSSFRG---YQGNSLELLSQMADVVLSD
A0A8C6QF32_BCL2A1-      SRVLQKVAFSVQKEVEKNLKPYLDNFDV---VSIDTARTIFNQVMEKEFE
A0A8C6R201_BCL2A1-      ------IVFSVQKEVEQNLKLYLDNFDV---VPTDTASTIFNQVMEKEFE
A0A8C6W748_BCL2L1-      VAVKQ-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFR
A0A8C6RID6_BCL2-02      PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFR
A0A8C6RID6_BCL2-01      PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFR
A0A8C6QA84_MCL1-01      GRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
A0A8C6RJE0_BCL2L2-      ADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQ
A0A8C6RJE0_BCL2L2-      ADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQ
                                  .           :  :                 .      

A0A8C6WBP6_BCL2L10      QQSLNWGRVVVLVAFAGMLLDQSPCKNTKGRNRLHVLRDCLYMVDLLCTR
A0A8C6QF32_BCL2A1-      DGIINWGRIVTIFAFGGVLLKKLPQEQMD--LDVDTYKQVSYFVAEFIMN
A0A8C6R201_BCL2A1-      DGIINWGRIVTIFAFGGVFLKELPQEQMD--LDVDTYKQVSCFVAEFIKN
A0A8C6W748_BCL2L1-      DG-VNWGRIVAFFSFGGALCVESVDKEMQ-----VLVSRIASWMATYLND
A0A8C6RID6_BCL2-02      DG-VNWGRIVAFFEFGGVMCVESVNREMS-----PLVDNIALWMTDYLNR
A0A8C6RID6_BCL2-01      DG-VNWGRIVAFFEFGGVMCVESVNREMS-----PLVDNIALWMTDYLNR
A0A8C6QA84_MCL1-01      DGVTNWGRIVTLISFGAFVAKHLKSINQE-----SCIDPLAESITDVLVR
A0A8C6RJE0_BCL2L2-      GG-PNWGRLVAFFVFGAALCAESVNKEME-----PLVGQVQDWMVTYLET
A0A8C6RJE0_BCL2L2-      GG-PNWGRLVAFFVFGAALCAESVNKEME-----PLVGQVQDWMVTYLET
                            ****:*.:. *.. .       : .              :      

A0A8C6WBP6_BCL2L10      LTGRHRAWLEAQDDW-DGFCRFFRRPFPLSF-------------------
A0A8C6QF32_BCL2A1-      NTG---EWIRQNGGWEDGFIRKFEPKSGWLT-------------------
A0A8C6R201_BCL2A1-      NTG---EWIRQNGGWVYGFIRKFEPKSGWLT-------------------
A0A8C6W748_BCL2L1-      HLE---PWIQENGGWD-TFVELYGNNAAAESRKGQERF------------
A0A8C6RID6_BCL2-02      HLH---TWIQDNGGW-----------------------------------
A0A8C6RID6_BCL2-01      HLH---TWIQDNGGWD-AFVELYGPSVRPLFDFSWLSL------------
A0A8C6QA84_MCL1-01      TKR---DWLVKQKGWD-GFVEFFHVQDLE---------------------
A0A8C6RJE0_BCL2L2-      RLA---DWIHSSGGWA-EFTALYGDGALEEARRLRE--------------
A0A8C6RJE0_BCL2L2-      RLA---DWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPP
                               *:  . .*                                   

A0A8C6WBP6_BCL2L10      -------------------WRRLLLQMFLSCFFA----------------
A0A8C6QF32_BCL2A1-      -------------------FLEVMGQIW----------------------
A0A8C6R201_BCL2A1-      -------------------FLEVMGQIW----------------------
A0A8C6W748_BCL2L1-      -------------------NRWFLTGMTVAGVVL----------------
A0A8C6RID6_BCL2-02      ----------------------------VGAHLT----------------
A0A8C6RID6_BCL2-01      -------------------KTLLSLAL-VGACIT----------------
A0A8C6QA84_MCL1-01      -GGIRNV------------LLAFAGVAGVGAGLA----------------
A0A8C6RJE0_BCL2L2-      -GNWASV------------RTVLTGAVALGALVT----------------
A0A8C6RJE0_BCL2L2-      PGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT
                                                                          

A0A8C6WBP6_BCL2L10      --------------------------------------------------
A0A8C6QF32_BCL2A1-      --------------------------------------------------
A0A8C6R201_BCL2A1-      --------------------------------------------------
A0A8C6W748_BCL2L1-      --------------------------------------------------
A0A8C6RID6_BCL2-02      --------------------------------------------------
A0A8C6RID6_BCL2-01      --------------------------------------------------
A0A8C6QA84_MCL1-01      --------------------------------------------------
A0A8C6RJE0_BCL2L2-      --------------------------------------------------
A0A8C6RJE0_BCL2L2-      ILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRP
                                                                          

A0A8C6WBP6_BCL2L10      ----------------------------------------------IGIL
A0A8C6QF32_BCL2A1-      -----------------------------------------------ELI
A0A8C6R201_BCL2A1-      -----------------------------------------------ELI
A0A8C6W748_BCL2L1-      ----------------------------------------------LGSL
A0A8C6RID6_BCL2-02      ----------------------------------------------EGVW
A0A8C6RID6_BCL2-01      ----------------------------------------------LGAY
A0A8C6QA84_MCL1-01      --------------------------------------------------
A0A8C6RJE0_BCL2L2-      ----------------------------------------------VGAF
A0A8C6RJE0_BCL2L2-      GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSW
                                                                          

A0A8C6WBP6_BCL2L10      YLWKRL-----
A0A8C6QF32_BCL2A1-      FLLKHHH----
A0A8C6R201_BCL2A1-      FLLK-------
A0A8C6W748_BCL2L1-      FSRK-------
A0A8C6RID6_BCL2-02      VSVIIFWYPGR
A0A8C6RID6_BCL2-01      LGHK-------
A0A8C6QA84_MCL1-01      YLIR-------
A0A8C6RJE0_BCL2L2-      FASK-------
A0A8C6RJE0_BCL2L2-      YSPY-------
                                   

© 1998-2022Legal notice