Dataset for protein BCL-2-like of organism Nannospalax galili

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A8C6QA84_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nannospalax galili GN=MCL-1 (length=340 residues).
MFGLRRNAVIGLNLYCGGASLAAGGSSPAGARLVAEEAKARCEGGGEAGAGSGGSVSGPAALLPDARRVARPPPIGAEVP
DVTATPEKLMLFPAGRASPPEDMAAPAAAIMSPEEELDGYEPEPLGKRPAVLPLRGLVGEAAKSSGTDGSLPSTPPPVEE
DDELYRQSLAIISRYLREQATGAKDAKPLGGAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVRTKRDWLVKQKGWDGFVEFFHVQDLEGGIRN
VLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6QF32_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nannospalax galili GN=BCL2A1 (length=175 residues).
MTDCEFTSVYSLAEDYLQYVLQVPLFESAPSKTSRVLQKVAFSVQKEVEKNLKPYLDNFDVVSIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQMDLDVDTYKQVSYFVAEFIMNNTGEWIRQNGGWEDGFIRKFEPKSGWLTFLEV
MGQIWELIFLLKHHH
>gnl|bcl2dbpro|A0A8C6R201_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Nannospalax galili GN=BCL2A1 (length=154 residues).
YSLAEDYLQYVLQVPSFESAPIVFSVQKEVEQNLKLYLDNFDVVPTDTASTIFNQVMEKEFEDGIINWGRIVTIFAFGGV
FLKELPQEQMDLDVDTYKQVSCFVAEFIKNNTGEWIRQNGGWVYGFIRKFEPKSGWLTFLEVMGQIWELIFLLK
>gnl|bcl2dbpro|A0A8C6RID6_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL-2 (length=213 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAG
QALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTDYLNRHLHTWIQDNGGWVGAHLTEGVWVSVIIFWYPGR
>gnl|bcl2dbpro|A0A8C6RID6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL-2 (length=236 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAG
QALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTDYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C6RJE0_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C6RJE0_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A8C6W748_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREL
IPMVAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6WBP6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L10 (length=183 residues).
MADPLRERTRQLLIDYLLFCAREPGTRELPPSSSEAAVLRSVAAQTLQLHQPFFSSFRGYQGNSLELLSQMADVVLSDQQ
SLNWGRVVVLVAFAGMLLDQSPCKNTKGRNRLHVLRDCLYMVDLLCTRLTGRHRAWLEAQDDWDGFCRFFRRPFPLSFWR
RLLLQMFLSCFFAIGILYLWKRL
© 1998-2022Legal notice