Dataset for protein Bcl-2 of organism Nannospalax galili

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240
********************************                              *** :* *.::.      
                                dafvelygpsvrplfdfswlslktllslal   ci e awlghiifwy

© 1998-2023Legal notice