Dataset for protein Bcl-2 of organism Nannospalax galili

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6RID6_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL-2 (length=213 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAG
QALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTDYLNRHLHTWIQDNGGWVGAHLTEGVWVSVIIFWYPGR
>gnl|bcl2dbpro|A0A8C6RID6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nannospalax galili GN=BCL-2 (length=236 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFSSLPGSNPTAAVHQDPAARTSPPRLPAAMAG
QALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTDYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2022Legal notice