Dataset for protein Bcl-2 of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6RID6_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFS
A0A8C6RID6_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGATPAPGIFS
                        **************************************************

A0A8C6RID6_BCL2-02      SLPGSNPTAAVHQDPAARTSPPRLPAAMAGQALSPVPPVVHLTLRQAGDD
A0A8C6RID6_BCL2-01      SLPGSNPTAAVHQDPAARTSPPRLPAAMAGQALSPVPPVVHLTLRQAGDD
                        **************************************************

A0A8C6RID6_BCL2-02      FSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEF
A0A8C6RID6_BCL2-01      FSRRYRRDFAEMSSQLHLTPFTARGRFVTVVEELFRDGVNWGRIVAFFEF
                        **************************************************

A0A8C6RID6_BCL2-02      GGVMCVESVNREMSPLVDNIALWMTDYLNRHLHTWIQDNGGW--------
A0A8C6RID6_BCL2-01      GGVMCVESVNREMSPLVDNIALWMTDYLNRHLHTWIQDNGGWDAFVELYG
                        ******************************************        

A0A8C6RID6_BCL2-02      ----------------------VGAHLTEGVWVSVIIFWYPGR
A0A8C6RID6_BCL2-01      PSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK-------
                                              *** :* *.::.         

© 1998-2022Legal notice