Dataset for protein BCL-2-like of organism Mus spicilegus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlhk
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     :          
-------------------------------------------------------------------meesed-lyrqsr
spgllavppeemaasaaaaivspeeeldgcepeaigkrpavlpllervseaakssgadgslpstppppsqe--d---n-l
                                                                    adyqrtgltyih
                                                                    t ag p hmrt 
                                                                           feh  
                                                                            d   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   ::                                                                         
elisrylryqltgskdskp-------------------------------------------------------------
sivehfiqevasvpgyewaqfsdveenrteapgdteaerltpsptpgnpswqpesspmvnpavhrssslrtstvrpmvat
r avd fsfk qqrafpss            ae ad apegaaain if fhladn a  g tghdmaadareli la  
  lmk  h c rekdt ed                                                             
       f                                                                        
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *. .   ..      :     .        .      ::         **..:* :: *.. :  
------pagrraletLrrvgdgvqrnhetafqsmlrklhiknegtvk-sfsrvmvkvfkdg-tNWgriVtlfsFggvlak
algeagas-avv--l qsaafsfskeyrrnlsgytsqfdvtsi-dariianqlvehlqr--vv  sql aiia aafvlv
 gpals--t--rkqv  e trqieqrvqkf kelsdd-rlepldl yqr et lsee e  ii   k  mflt   tmcn
       vqsyehla      e  l  ged adfces  gnrge   hm dk  n d d   f         e   a 
       pppc aa       d                    f    g  a   k                         
        k                                                                       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :      .:    .*                               
-------------hlksvnqvsc--plaetitevlvrtkrdwlvkqggW-dgfv-lfkpsl-------------------
kspymavkqrgdlqrem-vled-ie-v-swmadyinnntgeriqrnrd vv--lkfygnntgwlffwiigvlcasllcka
elv          rn--s----aylris-fyntfmmdhlht  wql   esvw-e-qpvqsplktwr             
qg           nkrlqptrg ckq-nllv ll g rhes  red    ptlirv lkprafgsrl             
             deqiild     n  f l         p  ed      p cdk hhkm ae  k             
              d  a       i                  a      a   i edfd                   
                                                            a                   

       410       420       430       440       450   
....:....|....:....|....:....|....:....|....:....|...
                                                     
--------------------------ltggivgglfllg--------------
iishtvnykkkkrprfttsrlslsafvsstfkta-----allgvkgrltylmr
           gqklknffwelirwqqqlsywp-vvtnwsyfsryagiaqei 
            kek d     eqtlmecqtrnvqspirkvalkg        
                       k gi  msiesilffkgr  h         
                             fladmcia c              
                             a  a  h  a              
© 1998-2023Legal notice