Dataset for protein BCL-2-like of organism Mus spicilegus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlhk
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .      .                                   
---------------------------dgtepeaigtrplvldyleyvleqkgysga-----------------------
spgllavppeemaasaaaaivspeeel-qcpastpdkhsaaeplvqrkssaaksecgqfsdveenrteapgdteaerdgs
                         mmmms------n eilahfig---rvpafvws            ae ad apltp
                          asaqgytlyyi a  vk f-   q--- fsd                    e a
                           asadslhtr  r  s   s   - r                            
                               r gmh     m   h                                  
                                 fe                                             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        .   .       :  :      . 
------------------------------------a-p---egpagrvllqtlrrvgdevqrnhrrafsdmlrqlhitp
lpstppppeeeeddlyrqsleiisrylreqatgskdsk-lgeasa-adraheamfsaqkgfetryetylqglhvk---sn
satpgnfswqpasspmvnpavhrdssadtstvrpmv-gagtpp--v--pvqrva a trqiskelkst dsfase dvki
a in i  fhl  n a  g tgh ma  areli lart dpa-pqpys-ekll  e   d gq fqef ae ta-  l r
                                     e    l k tpl aa          l    d    se      
                                              p                         c       
                                              c                                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .  :    :  .   **..:* :: *.. :                      :                 :   
gtavqsFsqVmvelFkdGv--NWGriVtlfsFGgvlckelvsvemeslvgplae---wmte--------------ylvrt
egdrkrvtrmvdkvlrgdpdt  sql afiv aafvavhspnknq-pcieqvqdvsstiadtrdcclivnflynlvintr
dsrqii nt sehe qk i i   k  mila   amlakgkqr--s-----i--   flva              fmmnn
fn ygl kh an    q f         t   t mnq  ymqvqvr sr-rs   rviv              l edh
   le    k                e          deaikqd dnykq      t                g  
                                        d  al   d  n                          
                                                  a  l                          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .:    .*                .                                                    
lrdWivkqgGWdg-----------fvely------------------------------------rtlltgavvlgllll
kgerlqsnrd vegfikkfkpssgwlafqiigvlcasllckaigssgdgalekarrlregnwasv--vvssgikg-afvt
tat  hrs   av      ekkr lt-vf              ipntvnysrekqprfttfrl lvwtqqqtfasv--a-
hhs  wql   pt            ktiw               nhmnaekk gkkkpnfs e psrqmilsywpsvv-n
 ep  red   es            cr l                 ka       e kl     hkqgiecqtrnmqstf
     ed     p             k                   a           d     ehnf   msleafip 
      a     d             f                                      dfd    lid ch  
            a             d                                       a       a     

       410     
....:....|....:
               
v--f-----------
ggl-gakkrltylmr
aaalfwsrliaqei 
-syasvygg      
riv lrga       
k f ik         
c    h         
               
© 1998-2022Legal notice