Dataset for protein BCL-2-like of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6GJU8_MCL1-02      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-03      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-01      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6G6C7_BCL2L1-      --------------------------------------------------
A0A8C6H5J8_BCL2-01      --------------------------------------------------
A0A8C6IEV0_BCL2L10      --------------------------------------------------
A0A8C6GN16_BCL2A1-      --------------------------------------------------
A0A8C6H5H7_BCL2A1-      --------------------------------------------------
                                                                          

A0A8C6GJU8_MCL1-02      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-03      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-01      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6G6C7_BCL2L1-      --------------------------------------------------
A0A8C6H5J8_BCL2-01      --------------------------------------------------
A0A8C6IEV0_BCL2L10      --------------------------------------------------
A0A8C6GN16_BCL2A1-      --------------------------------------------------
A0A8C6H5H7_BCL2A1-      --------------------------------------------------
                                                                          

A0A8C6GJU8_MCL1-02      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
A0A8C6GJU8_MCL1-03      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
A0A8C6GJU8_MCL1-01      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEE
A0A8C6G6C7_BCL2L1-      -----------------------------------------------MSQ
A0A8C6H5J8_BCL2-01      -----------------------------------------------MAQ
A0A8C6IEV0_BCL2L10      -----------------------------------------------MAD
A0A8C6GN16_BCL2A1-      -----------------------------------------------MSE
A0A8C6H5H7_BCL2A1-      -----------------------------------------------MTE
                                                                         :

A0A8C6GJU8_MCL1-02      EEDDLYRQSLEIISRYLREQATGSKDSKP---------------------
A0A8C6GJU8_MCL1-03      EEDDLYRQSLEIISRYLREQATGSKDSKP---------------------
A0A8C6GJU8_MCL1-01      EEDDLYRQSLEIISRYLREQATGSKDSKP---------------------
A0A8C6G6C7_BCL2L1-      S------N-RELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEDTEAERE
A0A8C6H5J8_BCL2-01      AGRTGYDN-REIVMKYIHYKLSQRGYEWD------------AGDADAAPL
A0A8C6IEV0_BCL2L10      SQDPLHERTRRLLSDYIFFCAREPDTPEP---------------------
A0A8C6GN16_BCL2A1-      YE---FTYIHSLAEHYLQYVLQVPAFESA---------------------
A0A8C6H5H7_BCL2A1-      SE---LMHIHSLAEHYFQYVLQVPAFESA---------------------
                                   :   ::                                 

A0A8C6GJU8_MCL1-02      -----------------------------------------LGEAGAAGR
A0A8C6GJU8_MCL1-03      -----------------------------------------LGEAGAAGR
A0A8C6GJU8_MCL1-01      -----------------------------------------LGEAGAAGR
A0A8C6G6C7_BCL2L1-      TPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA-----------
A0A8C6H5J8_BCL2-01      GAAPTPGIFSFQPESNPM--PAVHRDMAARTSTLRPLVATAGPALSPVPP
A0A8C6IEV0_BCL2L10      ----------------------------------------------PPTS
A0A8C6GN16_BCL2A1-      ----------------------------------------------PSQA
A0A8C6H5H7_BCL2A1-      ----------------------------------------------PSKA
                                                                          

A0A8C6GJU8_MCL1-02      RALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVK-SFSRVMVHVFKD
A0A8C6GJU8_MCL1-03      RALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVK-SFSRVMVHVFKD
A0A8C6GJU8_MCL1-01      RALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVK-SFSRVMVHVFKD
A0A8C6G6C7_BCL2L1-      -VKQALREAGDEFELRYRRAFSDLTSQLHITPG-TAYQSFEQVVNELFRD
A0A8C6H5J8_BCL2-01      VVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVEELFRD
A0A8C6IEV0_BCL2L10      VEAALLRSVTRQIQQEHQEFFSSFCES-RGNRLELVKHMADKLLSKDQD-
A0A8C6GN16_BCL2A1-      YR--LLQRVAFSVQKEVGKNLKSYLDDFHVESIDTARIIFNQVMKKEFED
A0A8C6H5H7_BCL2A1-      CR--VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFED
                             *. .   ..      :     .        .      ::      

A0A8C6GJU8_MCL1-02      GVTNWGRIVTLISFGAFVAK-------------HLKSVNQESCIEPLAET
A0A8C6GJU8_MCL1-03      GVTNWGRIVTLISFGAFVAK-------------HLKSVNQESCIEPLAET
A0A8C6GJU8_MCL1-01      GVTNWGRIVTLISFGAFVAK-------------HLKSVNQESCIEPLAET
A0A8C6G6C7_BCL2L1-      G-VNWGRIVAFFSFGGALCVESV----------DKEMQVLVS---RIASW
A0A8C6H5J8_BCL2-01      G-VNWGRIVAFFEFGGVMCVESV----------NREMSPLVD---NIALW
A0A8C6IEV0_BCL2L10      --FNWSQLVMLLAFAGTLMNQGPYMAVKQRGDLRNRLIVTRDCCLIVNFL
A0A8C6GN16_BCL2A1-      GIINWGKIVTIFTFGGVLLKKLP----------QD--------------F
A0A8C6H5H7_BCL2A1-      GIINWGRIVTIFAFGGVLLKKLP----------QEQIALDVGAYKQVSSF
                           **..:* :: *.. :                                

A0A8C6GJU8_MCL1-02      ITDVLVRTKRDWLVKQRGW-DGFVEFFHVQD-------------------
A0A8C6GJU8_MCL1-03      ITDVLVRTKRDWLVKQRGW-VVLL-IQLDNL-------------------
A0A8C6GJU8_MCL1-01      ITDVLVRTKRDWLVKQRGW-PPWLKVQPHFT-------------------
A0A8C6G6C7_BCL2L1-      MATYLNDHLEPWIQENGGW-DTFVDLYGNNAAAESRK-------------
A0A8C6H5J8_BCL2-01      MTEYLNRHLHTWIQDNGGW-DAFVELYGPSM-------------------
A0A8C6IEV0_BCL2L10      YNLLMGRRHRSRLEALGGW-DGFCRFFKNPLPLGFWR-------------
A0A8C6GN16_BCL2A1-      LAEFIMNNTGEWIWQDGDWVS-----FKKSRGFKFFWIIGVLCASLLCKA
A0A8C6H5H7_BCL2A1-      VAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFL-------------
                            :      .:    .*                               

A0A8C6GJU8_MCL1-02      --------------------------LEGGIRNVLLAFAGVAGVGAGLAY
A0A8C6GJU8_MCL1-03      --------------------------QSSGFKP-----------------
A0A8C6GJU8_MCL1-01      --------------------------VTCSYKGSQSPNC-----------
A0A8C6G6C7_BCL2L1-      -----------GQERFN------RWFLTGMTVAGVVLLGSLFSRK-----
A0A8C6H5J8_BCL2-01      ------------RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK-----
A0A8C6IEV0_BCL2L10      -------------------RLLIQAFLSGFFATAIFFIWKRL--------
A0A8C6GN16_BCL2A1-      IISHTVNYKKKKKKKKTTFRESESAGIQGTSIDGLHLLRALLLKYGRITQ
A0A8C6H5H7_BCL2A1-      -------------------------QMTGQIWEMLFLLK-----------
                                                                          

A0A8C6GJU8_MCL1-02      LIR
A0A8C6GJU8_MCL1-03      ---
A0A8C6GJU8_MCL1-01      ---
A0A8C6G6C7_BCL2L1-      ---
A0A8C6H5J8_BCL2-01      ---
A0A8C6IEV0_BCL2L10      ---
A0A8C6GN16_BCL2A1-      EMR
A0A8C6H5H7_BCL2A1-      ---
                           

© 1998-2023Legal notice