Dataset for protein BCL-2-like of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6GJU8_MCL1-02      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-03      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6GJU8_MCL1-01      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAAL
A0A8C6G6C7_BCL2L1-      --------------------------------------------------
A0A8C6H5J8_BCL2-01      --------------------------------------------------
A0A8C6GN16_BCL2A1-      --------------------------------------------------
A0A8C6H5H7_BCL2A1-      --------------------------------------------------
A0A8C6MXN1_BCL2L2-      --------------------------------------------------
A0A8C6MXN1_BCL2L2-      --------------------------------------------------
A0A8C6IEV0_BCL2L10      --------------------------------------------------
                                                                          

A0A8C6GJU8_MCL1-02      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-03      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6GJU8_MCL1-01      LPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAI
A0A8C6G6C7_BCL2L1-      --------------------------------------------------
A0A8C6H5J8_BCL2-01      --------------------------------------------------
A0A8C6GN16_BCL2A1-      --------------------------------------------------
A0A8C6H5H7_BCL2A1-      --------------------------------------------------
A0A8C6MXN1_BCL2L2-      --------------------------------------------------
A0A8C6MXN1_BCL2L2-      --------------------------------------------------
A0A8C6IEV0_BCL2L10      --------------------------------------------------
                                                                          

A0A8C6GJU8_MCL1-02      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGA-------------
A0A8C6GJU8_MCL1-03      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGA-------------
A0A8C6GJU8_MCL1-01      VSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGA-------------
A0A8C6G6C7_BCL2L1-      ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAP
A0A8C6H5J8_BCL2-01      ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWD------------A
A0A8C6GN16_BCL2A1-      --------MSEYEFTYIHSLAEHYLQYVLQVPAFESA-------------
A0A8C6H5H7_BCL2A1-      --------MTESELMHIHSLAEHYFQYVLQVPAFESA-------------
A0A8C6MXN1_BCL2L2-      -------MATPASTPDTRALVADFVGYKLRQKGYVCG-------------
A0A8C6MXN1_BCL2L2-      -------MATPASTPDTRALVADFVGYKLRQKGYVCG-------------
A0A8C6IEV0_BCL2L10      -----MADSQDPLHERTRRLLSDYI--------FFCA-------------
                                         .      .                         

A0A8C6GJU8_MCL1-02      -------DGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
A0A8C6GJU8_MCL1-03      -------DGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
A0A8C6GJU8_MCL1-01      -------DGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
A0A8C6G6C7_BCL2L1-      EDTEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA---
A0A8C6H5J8_BCL2-01      GDADAAPLGAAPTPGIFSFQPESNPM--PAVHRDMAARTSTLRPLVATAG
A0A8C6GN16_BCL2A1-      --------------------------------------------------
A0A8C6H5H7_BCL2A1-      --------------------------------------------------
A0A8C6MXN1_BCL2L2-      ----------------------------------------------AGPG
A0A8C6MXN1_BCL2L2-      ----------------------------------------------AGPG
A0A8C6IEV0_BCL2L10      ----------------------------------------------REPD
                                                                          

A0A8C6GJU8_MCL1-02      GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRV
A0A8C6GJU8_MCL1-03      GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRV
A0A8C6GJU8_MCL1-01      GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRV
A0A8C6G6C7_BCL2L1-      ---------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
A0A8C6H5J8_BCL2-01      PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV
A0A8C6GN16_BCL2A1-      --PSQAYRLLQRVAFSVQKEVGKNLKSYLDDFHVE---SIDTARIIFNQV
A0A8C6H5H7_BCL2A1-      --PSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVE---SIDTARIIFNQV
A0A8C6MXN1_BCL2L2-      --EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A8C6MXN1_BCL2L2-      --EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A8C6IEV0_BCL2L10      TPEPPPTSVEAALLRSVTRQIQQEHQEFFSSFCE----SRGNRLELVKHM
                                        .   .       :  :      .       .  :

A0A8C6GJU8_MCL1-02      MVHVFKDGV-TNWGRIVTLISFGAFVAKHLKSVNQESCIEPLAE---TIT
A0A8C6GJU8_MCL1-03      MVHVFKDGV-TNWGRIVTLISFGAFVAKHLKSVNQESCIEPLAE---TIT
A0A8C6GJU8_MCL1-01      MVHVFKDGV-TNWGRIVTLISFGAFVAKHLKSVNQESCIEPLAE---TIT
A0A8C6G6C7_BCL2L1-      VNELFRDGV--NWGRIVAFFSFGGALCVESVDKEMQVLVSRIAS---WMA
A0A8C6H5J8_BCL2-01      VEELFRDGV--NWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL---WMT
A0A8C6GN16_BCL2A1-      MKKEFEDGI-INWGKIVTIFTFGGVLLKKLPQD--------------FLA
A0A8C6H5H7_BCL2A1-      MEKEFEDGI-INWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVA
A0A8C6MXN1_BCL2L2-      SDELFQGGP--NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQD---WMV
A0A8C6MXN1_BCL2L2-      SDELFQGGP--NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQD---WMV
A0A8C6IEV0_BCL2L10      ADKLLSKDQDFNWSQLVMLLAFAGTLMNQGPYMAVKQR-GDLRN---RLI
                            :  .   **..:* :: *.. :                      : 

A0A8C6GJU8_MCL1-02      D--------------VLVRTKRDWLVKQRGWDG-----------FVEFF-
A0A8C6GJU8_MCL1-03      D--------------VLVRTKRDWLVKQRGWVV-----------LL-IQ-
A0A8C6GJU8_MCL1-01      D--------------VLVRTKRDWLVKQRGWPP-----------WLKVQ-
A0A8C6G6C7_BCL2L1-      T--------------YLNDHLEPWIQENGGWDT-----------FVDLY-
A0A8C6H5J8_BCL2-01      E--------------YLNRHLHTWIQDNGGWDA-----------FVELY-
A0A8C6GN16_BCL2A1-      E--------------FIMNNTGEWIWQDGDWVS-----FKKSRGFKFFWI
A0A8C6H5H7_BCL2A1-      E--------------FIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFL-
A0A8C6MXN1_BCL2L2-      A--------------YLETRLADWIHSSGGWAE-----------FTALY-
A0A8C6MXN1_BCL2L2-      A--------------YLETRLADWIHSSGGWAE-----------FTALY-
A0A8C6IEV0_BCL2L10      VTRDCCLIVNFLYNLLMGRRHRSRLEALGGWDG-----------FCRFF-
                                        :      .:    .*                .  

A0A8C6GJU8_MCL1-02      ----------------------------------HVQDLEGGIRNVLLAF
A0A8C6GJU8_MCL1-03      ----------------------------------LDNLQSSGFKP-----
A0A8C6GJU8_MCL1-01      ----------------------------------PHFTVTCSYKGSQSPN
A0A8C6G6C7_BCL2L1-      -------------GNNAAAESRKGQERFN------RWFLTGMTVAGVVLL
A0A8C6H5J8_BCL2-01      -------------GPSM-------RPLFDFSWLSLKTLLSLALVGACITL
A0A8C6GN16_BCL2A1-      IGVLCASLLCKAIISHTVNYKKKKKKKKTTFRESESAGIQGTSIDGLHLL
A0A8C6H5H7_BCL2A1-      -------------------------------------QMTGQIWEMLFLL
A0A8C6MXN1_BCL2L2-      ----------------GDGALEEARRLREGNWASVRTVLTGAVALGALVT
A0A8C6MXN1_BCL2L2-      ----------------GDGALEEARRLREGNWASVRTVLTGAVALGALVT
A0A8C6IEV0_BCL2L10      ----------------KN-------PLPLGFW---RRLLIQAFLSGFFAT
                                                                          

A0A8C6GJU8_MCL1-02      AGVAGVGAGLAYLIR
A0A8C6GJU8_MCL1-03      ---------------
A0A8C6GJU8_MCL1-01      C--------------
A0A8C6G6C7_BCL2L1-      GSLFSRK--------
A0A8C6H5J8_BCL2-01      GAYLGHK--------
A0A8C6GN16_BCL2A1-      RALLLKYGRITQEMR
A0A8C6H5H7_BCL2A1-      K--------------
A0A8C6MXN1_BCL2L2-      VGAFFASK-------
A0A8C6MXN1_BCL2L2-      VGAFFASK-------
A0A8C6IEV0_BCL2L10      AIFFIWKRL------
                                       

© 1998-2022Legal notice