Dataset for protein BCL-2-like of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8C6G6C7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEDTEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=310 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWVVLLIQLDNLQSSGFKP
>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=331 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVA
GVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6GJU8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Mus spicilegus GN=MCL-1 (length=317 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHK
SPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSL
EIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESCIEPLAETITDVLVRTKRDWLVKQRGWPPWLKVQPHFTVTCSYKGSQSPNC
>gnl|bcl2dbpro|A0A8C6GN16_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus spicilegus GN=BCL2A1 (length=205 residues).
MSEYEFTYIHSLAEHYLQYVLQVPAFESAPSQAYRLLQRVAFSVQKEVGKNLKSYLDDFHVESIDTARIIFNQVMKKEFE
DGIINWGKIVTIFTFGGVLLKKLPQDFLAEFIMNNTGEWIWQDGDWVSFKKSRGFKFFWIIGVLCASLLCKAIISHTVNY
KKKKKKKKTTFRESESAGIQGTSIDGLHLLRALLLKYGRITQEMR
>gnl|bcl2dbpro|A0A8C6H5H7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus spicilegus GN=BCL2A1 (length=172 residues).
MTESELMHIHSLAEHYFQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
>gnl|bcl2dbpro|A0A8C6H5J8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mus spicilegus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSTLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C6IEV0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L10 (length=191 residues).
MADSQDPLHERTRRLLSDYIFFCAREPDTPEPPPTSVEAALLRSVTRQIQQEHQEFFSSFCESRGNRLELVKHMADKLLS
KDQDFNWSQLVMLLAFAGTLMNQGPYMAVKQRGDLRNRLIVTRDCCLIVNFLYNLLMGRRHRSRLEALGGWDGFCRFFKN
PLPLGFWRRLLIQAFLSGFFATAIFFIWKRL
>gnl|bcl2dbpro|A0A8C6MXN1_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C6MXN1_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Mus spicilegus GN=BCL2L2 (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2022Legal notice