Dataset for protein Bfl1 of organism Mus spicilegus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*:* *: :********:**************:* *:************ **************************:****
 s s fmh        f              k c l            e                          e    

        90       100       110       120       130       140       150       160
*******.*****:***********:              *:************..:*.* .     *: . *:  *   
       k     a           dqialdvgaykqvss l            rqd d edgfikk ekkr fkf lii

       170       180       190       200       210       220    
                                     : *   : *.**.              
gvlcasllckaiishtvnykkkkkkkkttfresesagiq qiidg f  kalllkygritqemr
© 1998-2023Legal notice