Dataset for protein Bfl1 of organism Mus spicilegus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C6GN16_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus spicilegus GN=BCL2A1 (length=205 residues).
MSEYEFTYIHSLAEHYLQYVLQVPAFESAPSQAYRLLQRVAFSVQKEVGKNLKSYLDDFHVESIDTARIIFNQVMKKEFE
DGIINWGKIVTIFTFGGVLLKKLPQDFLAEFIMNNTGEWIWQDGDWVSFKKSRGFKFFWIIGVLCASLLCKAIISHTVNY
KKKKKKKKTTFRESESAGIQGTSIDGLHLLRALLLKYGRITQEMR
>gnl|bcl2dbpro|A0A8C6H5H7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Mus spicilegus GN=BCL2A1 (length=172 residues).
MTESELMHIHSLAEHYFQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQM
TGQIWEMLFLLK
© 1998-2022Legal notice